Property Summary

NCBI Gene PubMed Count 198
PubMed Score 6671.17
PubTator Score 3878.86

Knowledge Summary

Patent (252,139)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma 1.648 0.000

Synonym

Accession P08100 Q16414 Q2M249
Symbols RP4
OPN2
CSNBAD1

Gene

RHO

PANTHER Protein Class (2)

PDB

4ZWJ   5DGY  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (120)

PMID Text
26962691 Our study shows that RHO mutations are a major cause of adRP in this cohort and are responsible for 28% of adRP families.
26467309 analysis of the crystal structure of the rhodopsin-arrestin complex
26427449 Studies indicate that misfolding of rhodopsin can result in disruptions in cellular protein homeostasis, or proteostasis.
26321861 A whole-exome sequencing approach led to identification of a deletion in RHO through detection of a new linked variant in COL6A6 in autosomal dominant retinitis pigmentosa.
26200343 crystal structure of a constitutively active form of human rhodopsin bound to a pre-activated form of the mouse visual arrestin, determined by serial femtosecond X-ray laser crystallography
26114863 These insights into the dynamics of the ground states and the early photocycle stages enhance our understanding of the channel function of Channel rhodopsin.
26105054 show that although the basic activation pathways of human and bovine rhodopsin are similar, structural deviations exist in the inactive conformation and during receptor activation, even between closely related rhodopsins
26045836 RHO polymorphisms (rs7984, rs2855557 and rs2410) and haplotypes may confer remarkable susceptibility to age-related macular degeneration
25673879 FIP3 (RAB11-FIP3) promotes the activity of Rab11a and the ASAP1 in the Arf4-dependent ciliary transport of the sensory receptor rhodopsin.
25637522 Similar vacuolization in photoreceptor outer segment discs of transgenic mice expressing human rhodopsin with a T17M mutation or non-glycosylated form of rhodopsin was found. Non-glycosylated rhodopsin is unstable and is regulated via ubiquitin pathway
More...

AA Sequence

MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT      1 - 70
PLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVC     71 - 140
KPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNNESFVIYMFVV    141 - 210
HFTIPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQG    211 - 280
SNFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTETSQVAPA      281 - 348
//

Text Mined References (200)

PMID Year Title
26962691 2016 Genetic Analysis of the Rhodopsin Gene Identifies a Mosaic Dominant Retinitis Pigmentosa Mutation in a Healthy Individual.
26467309 2016 A structural snapshot of the rhodopsin-arrestin complex.
26427449 2016 Targeting the Proteostasis Network in Rhodopsin Retinitis Pigmentosa.
26321861 2015 New COL6A6 variant detected by whole-exome sequencing is linked to break points in intron 4 and 3'-UTR, deleting exon 5 of RHO, and causing adRP.
26200343 2015 Crystal structure of rhodopsin bound to arrestin by femtosecond X-ray laser.
26114863 2015 Molecular Dynamics of Channelrhodopsin at the Early Stages of Channel Opening.
26105054 2015 The Activation Pathway of Human Rhodopsin in Comparison to Bovine Rhodopsin.
26045836 2015 Haplotypes of RHO polymorphisms and susceptibility to age-related macular degeneration.
25673879 2015 The Arf and Rab11 effector FIP3 acts synergistically with ASAP1 to direct Rabin8 in ciliary receptor targeting.
25637522 2015 Glycosylation of rhodopsin is necessary for its stability and incorporation into photoreceptor outer segment discs.
More...