Property Summary

NCBI Gene PubMed Count 211
PubMed Score 6099.30
PubTator Score 3878.86

Knowledge Summary

Patent (252,139)

TINX Plot

  Disease (6)

Disease Target Count P-value
osteosarcoma 7950 3.6e-05
psoriasis 6694 7.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.648 3.6e-05
psoriasis 1.300 7.2e-04

Protein-protein Interaction (1)

Gene RIF (132)

AA Sequence

MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT      1 - 70
PLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVC     71 - 140
KPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNNESFVIYMFVV    141 - 210
HFTIPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQG    211 - 280
SNFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTETSQVAPA      281 - 348
//

Text Mined References (214)

PMID Year Title