Property Summary

NCBI Gene PubMed Count 821
Grant Count 1,092
R01 Count 613
Funding $79,502,074.22
PubMed Score 2286.34
PubTator Score 2112.40

Knowledge Summary

Patent (286,378)

Expression

Synonym

Accession P08069 B1B5Y2 Q14CV2 Q9UCC0
Symbols IGFR
CD221
IGFIR
JTK13

Gene

PDB

1IGR   1JQH   1K3A   1M7N   1P4O   2OJ9   2ZM3   3D94   3F5P   3I81   3LVP   3LW0   3NW5   3NW6   3NW7   3O23   3QQU   4D2R   4XSS   5HZN  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (734)

PMID Text
27172746 IGF1R expression in epithelial ovarian cancer is associated with estrogen and progesterone receptor positive status and HER2 non-amplification.
27048245 Our study demonstrates that the IGF1R/p110b/AKT/mTOR axis confers resistance to BYL719 in PIK3CA mutant breast cancers.
26991004 Full-length MGF directly stimulates the IGF-IR. Despite a higher EC50 concentration, at high equimolar concentrations full-length MGF showed a similar maximal potency to activate the IGF-IR as compared to IGF-I.
26910308 Data show that the lack of insulin like growth factor 1 receptor (IGFIR) resulted in an impaired cold acclimation.
26862994 Data indicate that a highly specific qRT-PCR assay to quantify levels of the insulin-like growth factor receptor and insulin receptor isoforms (IR-A, IR-B, and IGF-1R) on the same scale to provide a critical diagnostic and predictive tool.
26862168 IGF1R signaling was necessary for DC-mediated T-ALL survival.
26850678 Given the limited number of patients treated with KW-2450 in our study, it is not possible to make a meaningful comparison of efficacy with other IGF-1R/IR dual kinases inhibitors
26845446 MiR-133a suppresses osteosarcoma progression and metastasis by targeting IGF-1R in human osteosarcoma cell.
26826001 overexpression of the IGF-1R, and activation of GSK3beta and FOXO3a might be the molecular mechanisms underlying the development of liver cirrhosis
26801096 Anoikis resistance of oestrogen-responsive breast cancer cells depends upon IGF activation of the type I IGF receptor and PI3-kinase/Akt pathway.
More...

AA Sequence

MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDY      1 - 70
RSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGA     71 - 140
IRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNR    141 - 210
CQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRD    211 - 280
FCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQML    281 - 350
QGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF    351 - 420
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCES    421 - 490
DVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNK    491 - 560
DVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVK    561 - 630
WNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCC    631 - 700
ACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEE    701 - 770
LETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW    771 - 840
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSL    841 - 910
SGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEY    911 - 980
FSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNE    981 - 1050
ASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIA   1051 - 1120
DGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFT   1121 - 1190
TYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL   1191 - 1260
EIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPG   1261 - 1330
PGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC                                    1331 - 1367
//

Text Mined References (845)

PMID Year Title
27172746 2016 Positive expression of insulin-like growth factor-1 receptor is associated with a positive hormone receptor status in ovarian cancer.
27048245 2016 Activation of IGF1R/p110?/AKT/mTOR confers resistance to ?-specific PI3K inhibition.
26991004 2016 Potency of Full-Length MGF to Induce Maximal Activation of the IGF-I R Is Similar to Recombinant Human IGF-I at High Equimolar Concentrations.
26910308 2016 Essential Role of IGFIR in the Onset of Male Brown Fat Thermogenic Function: Regulation of Glucose Homeostasis by Differential Organ-Specific Insulin Sensitivity.
26862994 2016 Development of a Quantitative PCR Assay for Detection of Human Insulin-Like Growth Factor Receptor and Insulin Receptor Isoforms.
26862168 2016 Endogenous dendritic cells from the tumor microenvironment support T-ALL growth via IGF1R activation.
26850678 2016 Preclinical and first-in-human phase I studies of KW-2450, an oral tyrosine kinase inhibitor with insulin-like growth factor receptor-1/insulin receptor selectivity.
26845446 2016 MicroRNA-133a Inhibits Osteosarcoma Cells Proliferation and Invasion via Targeting IGF-1R.
26826001 2016 Hepatic IGF-1R overexpression combined with the activation of GSK-3? and FOXO3a in the development of liver cirrhosis.
26801096 2016 Insulin-like growth factors are essential to prevent anoikis in oestrogen-responsive breast cancer cells: importance of the type I IGF receptor and PI3-kinase/Akt pathway.
More...