Property Summary

Ligand Count 662
NCBI Gene PubMed Count 908
PubMed Score 2419.51
PubTator Score 2112.40

Knowledge Summary

Patent (286,378)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.8
Liver cancer 604 0.0 0.6
Disease Target Count Z-score Confidence
Gout 104 0.0 3.0
Disease Target Count Z-score Confidence
Degenerative disc disease 35 0.0 5.0

Expression

  Differential Expression (25)

Disease log2 FC p
diabetes mellitus -1.100 1.2e-02
Alzheimer's disease 1.200 4.4e-02
acute myeloid leukemia -1.300 2.2e-02
aldosterone-producing adenoma -1.369 3.2e-02
astrocytic glioma 1.100 4.5e-02
Astrocytoma, Pilocytic 1.400 1.1e-05
atypical teratoid / rhabdoid tumor 1.400 4.8e-03
Breast cancer -1.200 1.7e-02
ependymoma 1.300 1.9e-03
glioblastoma 1.300 1.6e-03
group 4 medulloblastoma 1.200 1.9e-02
interstitial cystitis -1.200 6.6e-04
intraductal papillary-mucinous carcinoma... -1.300 2.0e-03
intraductal papillary-mucinous neoplasm ... -1.100 3.0e-03
medulloblastoma, large-cell 1.500 1.6e-04
non-small cell lung cancer 1.263 3.8e-11
oligodendroglioma 1.700 9.6e-04
osteosarcoma 1.649 5.0e-02
ovarian cancer -1.500 1.7e-08
pancreatic ductal adenocarcinoma liver m... 1.072 2.2e-02
pediatric high grade glioma 1.200 5.5e-04
Pick disease 1.900 1.0e-05
primitive neuroectodermal tumor 1.400 2.3e-03
progressive supranuclear palsy 1.800 6.0e-03
spina bifida -1.093 2.7e-02

Gene RIF (818)

AA Sequence

MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDY      1 - 70
RSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGA     71 - 140
IRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNR    141 - 210
CQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRD    211 - 280
FCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQML    281 - 350
QGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF    351 - 420
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCES    421 - 490
DVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNK    491 - 560
DVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVK    561 - 630
WNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCC    631 - 700
ACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEE    701 - 770
LETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW    771 - 840
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSL    841 - 910
SGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEY    911 - 980
FSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNE    981 - 1050
ASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIA   1051 - 1120
DGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFT   1121 - 1190
TYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL   1191 - 1260
EIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPG   1261 - 1330
PGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC                                    1331 - 1367
//

Text Mined References (932)

PMID Year Title