Property Summary

NCBI Gene PubMed Count 17
PubMed Score 159.03
PubTator Score 112.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 2.200 2.5e-02
cystic fibrosis -2.000 1.3e-04
glioblastoma -1.800 1.1e-02
intraductal papillary-mucinous neoplasm ... -1.300 2.4e-02
malignant mesothelioma 1.900 8.3e-06
medulloblastoma, large-cell 1.100 5.7e-04
non primary Sjogren syndrome sicca -1.500 7.1e-03
pediatric high grade glioma -1.500 1.7e-02
spina bifida -1.923 3.8e-02

Gene RIF (1)

AA Sequence

MDEDEFELQPQEPNSFFDGIGADATHMDGDQIVVEIQEAVFVSNIVDSDITVHNFVPDDPDSVVIQDVVE      1 - 70
DVVIEEDVQCSDILEEADVSENVIIPEQVLDSDVTEEVSLPHCTVPDDVLASDITSTSMSMPEHVLTSES     71 - 140
MHVCDIGHVEHMVHDSVVEAEIITDPLTSDIVSEEVLVADCAPEAVIDASGISVDQQDNDKASCEDYLMI    141 - 210
SLDDAGKIEHDGSTGVTIDAESEMDPCKVDSTCPEVIKVYIFKADPGEDDLGGTVDIVESEPENDHGVEL    211 - 280
LDQNSSIRVPREKMVYMTVNDSQQEDEDLNVAEIADEVYMEVIVGEEDAAVAAAAAAVHEQQIDEDEMKT    281 - 350
FVPIAWAAAYGNNSDGIENRNGTASALLHIDESAGLGRLAKQKPKKKRRPDSRQYQTAIIIGPDGHPLTV    351 - 420
YPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYHCTDCDYTTNKKISLHNHLESHKLTSKAEKAIECDECG    421 - 490
KHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSKNFPHICVECGKGFRHPSELR    491 - 560
KHMRIHTGEKPYQCQYCEYRSADSSNLKTHIKTKHSKEMPFKCDICLLTFSDTKEVQQHTLVHQESKTHQ    561 - 630
CLHCDHKSSNSSDLKRHVISVHTKDYPHKCEMCEKGFHRPSELKKHVAVHKGKKMHQCRHCDFKIADPFV    631 - 700
LSRHILSVHTKDLPFRCKRCRKGFRQQNELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDY    701 - 770
PHRCEYCKKGFRRPSEKNQHIMRHHKEVGLP                                           771 - 801
//

Text Mined References (20)

PMID Year Title