Property Summary

NCBI Gene PubMed Count 16
Grant Count 3
Funding $102,554.4
PubMed Score 155.48
PubTator Score 112.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (1)

PMID Text
22407129 Studies identified a major testis-specific ZFY transcript that encodes a protein with the same short acidic domain.

AA Sequence

MDEDEFELQPQEPNSFFDGIGADATHMDGDQIVVEIQEAVFVSNIVDSDITVHNFVPDDPDSVVIQDVVE      1 - 70
DVVIEEDVQCSDILEEADVSENVIIPEQVLDSDVTEEVSLPHCTVPDDVLASDITSTSMSMPEHVLTSES     71 - 140
MHVCDIGHVEHMVHDSVVEAEIITDPLTSDIVSEEVLVADCAPEAVIDASGISVDQQDNDKASCEDYLMI    141 - 210
SLDDAGKIEHDGSTGVTIDAESEMDPCKVDSTCPEVIKVYIFKADPGEDDLGGTVDIVESEPENDHGVEL    211 - 280
LDQNSSIRVPREKMVYMTVNDSQQEDEDLNVAEIADEVYMEVIVGEEDAAVAAAAAAVHEQQIDEDEMKT    281 - 350
FVPIAWAAAYGNNSDGIENRNGTASALLHIDESAGLGRLAKQKPKKKRRPDSRQYQTAIIIGPDGHPLTV    351 - 420
YPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYHCTDCDYTTNKKISLHNHLESHKLTSKAEKAIECDECG    421 - 490
KHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSKNFPHICVECGKGFRHPSELR    491 - 560
KHMRIHTGEKPYQCQYCEYRSADSSNLKTHIKTKHSKEMPFKCDICLLTFSDTKEVQQHTLVHQESKTHQ    561 - 630
CLHCDHKSSNSSDLKRHVISVHTKDYPHKCEMCEKGFHRPSELKKHVAVHKGKKMHQCRHCDFKIADPFV    631 - 700
LSRHILSVHTKDLPFRCKRCRKGFRQQNELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDY    701 - 770
PHRCEYCKKGFRRPSEKNQHIMRHHKEVGLP                                           771 - 801
//

Text Mined References (19)

PMID Year Title
22407129 2012 Human and mouse ZFY genes produce a conserved testis-specific transcript encoding a zinc finger protein with a short acidic domain and modified transactivation potential.
20028140 2010 Characterization of the DNA binding activity of the ZFY zinc finger domain.
15557258 2004 Solvation and the hidden thermodynamics of a zinc finger probed by nonstandard repair of a protein crevice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11750730 Onset of sex differentiation: dialog between genes and cells.
11173854 2000 Three thousand years of questioning sex determination.
10779541 2000 Sex chromosomal transposable element accumulation and male-driven substitutional evolution in humans.
More...