Property Summary

NCBI Gene PubMed Count 781
Grant Count 841
R01 Count 571
Funding $71,263,589.97
PubMed Score 923.08
PubTator Score 2870.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Gene

SP1

PDB

1SP1   1SP2   1VA1   1VA2   1VA3  

 GWAS Trait (1)

Gene RIF (694)

PMID Text
27004687 This is the first study indicating that Sp1 signaling plays an important role in the regulation of human LRRK2 gene expression.
26981862 data suggests that CYP1B1 promotes cell proliferation and metastasis by inducing EMT and Wnt/beta-catenin signaling via Sp1 induction
26945968 These results suggest that STAT6 plays an important role in regulating Sp1 and BCL6 through STAT2 to exert the anti-proliferative effects of type I IFN.
26857392 RNAi-mediated WWOX knockdown in pancreatic cancer cells confirmed differential cytostatic drug sensitivity. In electrophoretic mobility shift assays, the A allele exhibited weaker binding of Sp family members Sp1/Sp3.
26828265 Thus, we conclude that the oncoprotein HBXIP up-regulates FGF4 through activating transcriptional factor Sp1 to promote the migration of breast cancer cells. Therapeutically, HBXIP may serve as a novel target in breast cancer.
26807725 Sp1 and Sp3 are not only essential for the basal transcription of the ek1 gene, their accessibility to the target site on the ek1 promoter is regulated by histone protein modification in a cell line dependent manner.
26771806 miR-23b/SP1/c-myc forms a feed-forward loop supporting multiple myeloma cell growth
26689593 The cross-talk between SP1 and p65, and the positive feedback regulatory loop of PI3-K/Akt signaling by EP4 contribute to the overall responses of solamargine in this process
26687764 these data indicate that activation of EGFR enhanced the expression of P2X7R in neuroblastoma cells lacking trophic support, being PI3K/Akt/PKC signaling pathway and Sp1 mediating this pro-survival outcome
26683615 TRIM22 acts as a suppressor of basal HIV-1 LTR-driven transcription by preventing Sp1 binding to the HIV-1 promoter
More...

AA Sequence

MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSR      1 - 70
IESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNR     71 - 140
TVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGA    141 - 210
NQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPS    211 - 280
SQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTN    281 - 350
SQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPL    351 - 420
SGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGV    421 - 490
SLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGD    491 - 560
HGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHI    561 - 630
QGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDH    631 - 700
LSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVM    701 - 770
QVADLQSINISGNGF                                                           771 - 785
//

Text Mined References (802)

PMID Year Title
27030318 2016 MicroRNA-29b promotes the adipogenic differentiation of human adipose tissue-derived stromal cells.
27004687 2016 Regulation of LRRK2 promoter activity and gene expression by Sp1.
26981862 2016 CYP1B1 Enhances Cell Proliferation and Metastasis through Induction of EMT and Activation of Wnt/?-Catenin Signaling via Sp1 Upregulation.
26945968 2016 The anti-proliferative effects of type I IFN involve STAT6-mediated regulation of SP1 and BCL6.
26857392 2016 Relevance of Sp Binding Site Polymorphism in WWOX for Treatment Outcome in Pancreatic Cancer.
26828265 2016 The oncoprotein HBXIP up-regulates FGF4 through activating transcriptional factor Sp1 to promote the migration of breast cancer cells.
26807725 2016 Sp1 and Sp3 Are the Transcription Activators of Human ek1 Promoter in TSA-Treated Human Colon Carcinoma Cells.
26771806 2016 miR-23b/SP1/c-myc forms a feed-forward loop supporting multiple myeloma cell growth.
26689593 2015 Inactivation of PI3-K/Akt and reduction of SP1 and p65 expression increase the effect of solamargine on suppressing EP4 expression in human lung cancer cells.
26687764 2015 PI3K/Akt signaling pathway triggers P2X7 receptor expression as a pro-survival factor of neuroblastoma cells under limiting growth conditions.
More...