Property Summary

NCBI Gene PubMed Count 857
PubMed Score 976.66
PubTator Score 2870.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.200 2.0e-06
ependymoma 1.500 9.1e-06
glioblastoma 2.000 2.4e-03
group 4 medulloblastoma 1.600 4.2e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.0e-03
medulloblastoma, large-cell 2.400 1.8e-06
osteosarcoma 2.676 2.9e-07
ovarian cancer -1.100 3.4e-05
pediatric high grade glioma 1.500 5.2e-03
Pick disease 1.100 4.5e-05
primary pancreatic ductal adenocarcinoma 1.201 1.4e-02
primitive neuroectodermal tumor 1.400 1.4e-03
psoriasis -1.400 2.6e-04

Protein-protein Interaction (1)

Gene RIF (748)

AA Sequence

MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSR      1 - 70
IESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNR     71 - 140
TVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGA    141 - 210
NQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPS    211 - 280
SQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTN    281 - 350
SQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPL    351 - 420
SGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGV    421 - 490
SLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGD    491 - 560
HGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHI    561 - 630
QGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDH    631 - 700
LSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVM    701 - 770
QVADLQSINISGNGF                                                           771 - 785
//

Text Mined References (879)

PMID Year Title