Property Summary

NCBI Gene PubMed Count 194
PubMed Score 861.61
PubTator Score 556.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (8)

Disease log2 FC p
lung adenocarcinoma 1.200 2.9e-02
lung cancer 2.200 4.8e-06
osteosarcoma 1.344 2.7e-06
ovarian cancer 1.500 4.1e-06
pancreatic cancer -1.200 8.2e-03
pancreatic ductal adenocarcinoma liver m... -1.009 3.0e-02
subependymal giant cell astrocytoma -1.515 1.3e-02
ulcerative colitis -1.200 7.9e-06

Gene RIF (120)

AA Sequence

MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVCYDQFFP      1 - 70
ISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVV     71 - 140
FRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEVV    141 - 210
YLIIRACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRC    211 - 280
SAC                                                                       281 - 283
//

Text Mined References (200)

PMID Year Title