Property Summary

Ligand Count 2
NCBI Gene PubMed Count 56
PubMed Score 324.53
PubTator Score 961.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma -1.346 1.4e-02
astrocytic glioma -1.900 4.6e-02
Astrocytoma, Pilocytic -1.400 2.9e-03
Becker muscular dystrophy 1.050 2.1e-04
Breast cancer 1.400 5.7e-03
breast carcinoma -1.500 1.0e-03
colon cancer -1.900 2.2e-02
Duchenne muscular dystrophy 1.141 9.3e-08
ductal carcinoma in situ -1.800 3.9e-04
ependymoma -1.400 8.7e-04
fibroadenoma -1.500 4.1e-02
group 4 medulloblastoma -1.800 4.8e-03
interstitial cystitis 1.200 9.8e-04
intraductal papillary-mucinous adenoma (... -2.800 2.1e-03
intraductal papillary-mucinous carcinoma... -4.300 1.2e-03
intraductal papillary-mucinous neoplasm ... -2.900 1.1e-02
invasive ductal carcinoma -1.800 6.3e-03
limb girdle muscular dystrophy 2A 1.247 6.2e-07
lung adenocarcinoma -1.600 6.3e-04
lung cancer -1.500 3.6e-03
lung carcinoma -1.700 1.3e-22
medulloblastoma, large-cell -1.100 4.2e-02
mucosa-associated lymphoid tissue lympho... 2.458 1.9e-02
nasopharyngeal carcinoma -1.200 7.7e-03
non-small cell lung cancer -1.603 5.7e-12
oligodendroglioma -1.100 1.7e-06
ovarian cancer -2.300 3.3e-05
pancreatic cancer -1.100 7.4e-03
primary pancreatic ductal adenocarcinoma -1.941 2.0e-02
psoriasis -1.800 1.3e-03

Gene RIF (29)

AA Sequence

MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKP      1 - 70
VNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEG     71 - 140
SPYVPVHFDASVEDST                                                          141 - 156
//

Text Mined References (58)

PMID Year Title