Property Summary

NCBI Gene PubMed Count 54
PubMed Score 314.26
PubTator Score 961.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.28342794077297E-22
non-small cell lung cancer 2798 5.66932880965573E-12
Duchenne muscular dystrophy 602 9.28518929404568E-8
lung cancer 4473 4.114031397613E-7
limb girdle muscular dystrophy 2A 156 6.15158819841314E-7
oligodendroglioma 2849 1.70834292428534E-6
ovarian cancer 8492 3.30844297511213E-5
Becker muscular dystrophy 187 2.09683349836269E-4
ductal carcinoma in situ 1745 3.90317619188016E-4
lung adenocarcinoma 2714 6.32095733039479E-4
interstitial cystitis 2299 9.83167465951179E-4
breast carcinoma 1614 0.00101810083692915
posterior fossa group B ependymoma 1530 0.00108751650140055
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00124829388152675
psoriasis 6685 0.00126705063299177
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00214264200576576
pilocytic astrocytoma 3086 0.00300268467927938
group 4 medulloblastoma 1875 0.00482859301329538
Breast cancer 3099 0.00572980484515725
invasive ductal carcinoma 2950 0.00634193160087085
nasopharyngeal carcinoma 1056 0.0076716671456406
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0105756735793759
adrenocortical carcinoma 1427 0.0144408144350414
pancreatic cancer 2300 0.0180165969895302
mucosa-associated lymphoid tissue lymphoma 480 0.0191006656672071
primary pancreatic ductal adenocarcinoma 1271 0.0200084118400189
colon cancer 1475 0.0216487241124589
fibroadenoma 557 0.0407805509299844
medulloblastoma, large-cell 6234 0.0424783484353197
astrocytic glioma 2241 0.0462639984218737
Disease Target Count Z-score Confidence
St. Louis encephalitis 5 3.914 2.0
T lymphocyte deficiency 7 3.306 1.7

Expression

Synonym

Accession P07998 B2R589 D3DS06 Q16830 Q16869 Q1KHR2 Q6ICS5 Q9UCB4 Q9UCB5
Symbols RAC1
RIB1
RNS1

Gene

PDB

1Z7X   2Q4G   1DZA   1E21   1H8X   2E0J   2E0L   2E0M   2E0O   2K11   3F8G   4KXH  

  Ortholog (7)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Cow OMA Inparanoid

Gene RIF (28)

PMID Text
25336120 Focusing on the increase in an N-glycosylated Asn residue of serum pancreatic ribonuclease 1, specifically Asn(88), affords a new diagnostic marker for pancreatic cancer
24100329 Deletion of five residues in the hinge loop of pancreatic ribonuclease induces formation of a domain-swapped dimer that leads to the generation of linear aggregates of pancreatic RNase, revealed by the crystal packing.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of RNase A ribonuclease 1 (RNASE1) in peptide-treated PBMCs
23135272 The reduced conformational flexibility of eosinophil cationic protein can be dynamically and functionally reproduced in the RNase A scaffold.
22190034 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of RNase A ribonuclease 1 (RNASE1) in peptide-treated PBMCs
21767499 The role on the dimerization process of different residues of a domain-swapped dimer human pancreatic ribonuclease variant.
21408145 In human pancreatic ribonuclease both glutamine 28 and arginine 39 are important for the cleavage of dsRNA.
21103661 Vascular RNase1 and RNase5 are mainly produced by vascular endothelial cells and can serve, depending on the vascular bed, different functions in vascular homeostasis and endothelial cell responses.
20352290 The nuclear transport of PE5 is critical for its cytotoxicity.
19156888 Studies illustrate of the making dimeric pancreatic RNase through removal by directed mutagenesis of most of the N-terminal alpha-helix to the remainder of the protein.
More...

AA Sequence

MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKP      1 - 70
VNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEG     71 - 140
SPYVPVHFDASVEDST                                                          141 - 156
//

Text Mined References (56)

PMID Year Title
25336120 2014 Increased N-glycosylation of Asn?? in serum pancreatic ribonuclease 1 is a novel diagnostic marker for pancreatic cancer.
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
24100329 2013 Three-dimensional domain swapping and supramolecular protein assembly: insights from the X-ray structure of a dimeric swapped variant of human pancreatic RNase.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23135272 2012 Conservation of flexible residue clusters among structural and functional enzyme homologues.
21767499 2011 Interactions crucial for three-dimensional domain swapping in the HP-RNase variant PM8.
21408145 2011 Functional role of glutamine 28 and arginine 39 in double stranded RNA cleavage by human pancreatic ribonuclease.
21103661 2011 Expression and localisation of vascular ribonucleases in endothelial cells.
More...