Property Summary

NCBI Gene PubMed Count 96
PubMed Score 251.75
PubTator Score 450.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia -1.300 1.1e-02
aldosterone-producing adenoma -1.522 2.7e-02
astrocytic glioma -1.300 5.0e-02
group 3 medulloblastoma 1.800 1.6e-02
lung cancer 1.300 2.5e-03
medulloblastoma, large-cell 1.800 1.3e-03
non-small cell lung cancer 1.121 2.0e-10
ovarian cancer 1.700 3.5e-04
pancreatic cancer -1.100 5.4e-03
pancreatic carcinoma -1.100 5.4e-03
pancreatic ductal adenocarcinoma liver m... -1.639 1.4e-03
Pick disease -1.100 3.4e-04
posterior fossa group B ependymoma 1.300 7.1e-04
psoriasis -2.200 1.8e-05
ulcerative colitis -1.100 5.1e-03

Gene RIF (77)

AA Sequence

MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAARMASQNSFRIEYDTFGELKVPNDKYYGA      1 - 70
QTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVV     71 - 140
WQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPG    141 - 210
LQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVG    211 - 280
TGLNTRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPR    281 - 350
SGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSA    351 - 420
RLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELG    421 - 490
YLTAEQFDEWVKPKDMLGPK                                                      491 - 510
//

Text Mined References (102)

PMID Year Title