Property Summary

NCBI Gene PubMed Count 69
Grant Count 17
R01 Count 8
Funding $1,463,365
PubMed Score 213.16
PubTator Score 89.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -2.600 0.000
glioblastoma multiforme 1.700 0.000
atypical teratoid/rhabdoid tumor 2.000 0.002
acute quadriplegic myopathy -1.789 0.000
primary pancreatic ductal adenocarcinoma 3.250 0.000
colon cancer -1.700 0.000
lung cancer 1.300 0.009
pancreatic cancer 3.100 0.000
group 4 medulloblastoma -1.300 0.006
Breast cancer -2.100 0.000
breast carcinoma -1.400 0.000
invasive ductal carcinoma -1.500 0.026
ovarian cancer -3.400 0.000

Gene RIF (41)

PMID Text
26708479 Despite its reduced affinity for actin in co-sedimentation assay, the Q147P mutant incorporates into the muscle fiber ..Q147P tropomyosin (TPM2)binds to actin in ghost muscle fiber.
26619148 tropomyosin 2.1 acts as a suppressor of growth on soft matrices by supporting proper rigidity sensing
25660542 Myo1c significantly increases the frequency of kinesin-1-driven microtubule-based runs that begin at actin/microtubule intersections. The actin-binding protein tropomyosin 2 abolishes Myo1c-specific effects on both run initiation and run termination.
25224486 Changes for CRMP2, TCP1epsilon, TPM2 and 14-3-3gamma were confirmed in experimental tumors and in a series of 28 human SI-NETs.
24692096 Patients with TPM2 mutations tended to present with milder symptoms than those with TPM3 mutations, DA being present only in the TPM2 group.
24657080 effect of the skeletal myopathy-causing E117K mutation in human beta-tropomyosin on actomyosin structure during the ATPase cycle
24507666 in a cohort of 94 patients with congenital myopathy, 2 related female patients and 2 sporadic male patients were found to carry mutations in TPM2 and TPM3 genes respectively; clinical presentation and muscle morphological findings differed in the patients
24039757 Histopathological phenotype association of muscle fibers expressing Beta-tropomyosin mutational variants that occur in human myopathies.
23792823 In addition to CLIC1 and TPM1, which were the proteins initially discovered in a xenograft mouse model, CLIC4, TPM2, TPM3, and TPM4 were present in ovarian cancer patient sera at significantly elevated levels compared with controls.
23689010 The E117K mutation in tropomyosin beta chain that causes nemaline myopathy shifts the tropomyosin strands to the closed position and suppresses their conformational rearrangements on the thin filament.
More...

AA Sequence

MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEK      1 - 70
LEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEK     71 - 140
MELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESKCGDLEEELKIVTNNLKSLEAQ    141 - 210
ADKYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALND    211 - 280
ITSL                                                                      281 - 284
//

Text Mined References (69)

PMID Year Title
26708479 2016 Myopathy-causing Q147P TPM2 mutation shifts tropomyosin strands further towards the open position and increases the proportion of strong-binding cross-bridges during the ATPase cycle.
26619148 2016 Tropomyosin controls sarcomere-like contractions for rigidity sensing and suppressing growth on soft matrices.
25660542 2015 Control of the initiation and termination of kinesin-1-driven transport by myosin-Ic and nonmuscle tropomyosin.
25369766 2015 A systematic nomenclature for mammalian tropomyosin isoforms.
25224486 2015 Mechanisms of local invasion in enteroendocrine tumors: identification of novel candidate cytoskeleton-associated proteins in an experimental mouse model by a proteomic approach and validation in human tumors.
24692096 2014 Mutation update and genotype-phenotype correlations of novel and previously described mutations in TPM2 and TPM3 causing congenital myopathies.
24657080 2014 The E117K mutation in ?-tropomyosin disturbs concerted conformational changes of actomyosin in muscle fibers.
24507666 2014 Frequency and phenotype of patients carrying TPM2 and TPM3 gene mutations in a cohort of 94 patients with congenital myopathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24039757 2013 Phenotypes of myopathy-related beta-tropomyosin mutants in human and mouse tissue cultures.
More...