Property Summary

NCBI Gene PubMed Count 707
PubMed Score 2681.08
PubTator Score 3384.44

Knowledge Summary

Patent (180,270)

TINX Plot

  Disease Sources (10)

Disease Target Count P-value
breast carcinoma 1614 1.65442797755976E-21
ovarian cancer 8492 1.07995214562114E-9
posterior fossa group B ependymoma 1530 2.66252494870761E-7
Breast cancer 3099 1.73003593330738E-5
atypical teratoid/rhabdoid tumor 1095 2.77232703954301E-5
medulloblastoma, large-cell 6234 1.37429639944432E-4
osteosarcoma 7933 1.78848181138596E-4
psoriasis 6685 4.77910511201436E-4
group 3 medulloblastoma 2254 0.00247060356005387
pituitary cancer 1972 0.00361084873589954
aldosterone-producing adenoma 664 0.0153933023039898
astrocytic glioma 2241 0.0431286439945439
pediatric high grade glioma 2712 0.0442614452044746
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 2.0
Thyroid cancer 25 0.0 2.0
Disease Target Count Z-score Confidence
Intestinal disease 11 0.0 2.0
Disease Target Count Z-score Confidence
Paraganglioma 12 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 6.237 3.1

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 1.100 0.043
psoriasis 1.200 0.000
osteosarcoma -1.458 0.000
posterior fossa group B ependymoma -1.900 0.000
group 3 medulloblastoma -2.200 0.002
atypical teratoid/rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -1.900 0.000
pediatric high grade glioma -1.100 0.044
aldosterone-producing adenoma -1.792 0.015
breast carcinoma 1.400 0.000
Breast cancer 2.700 0.000
ovarian cancer 1.500 0.000
pituitary cancer -2.000 0.004

Synonym

Accession P07949 A8K6Z2 Q15250 Q9BTB0 Q9H4A2
Symbols PTC
MTC1
HSCR1
MEN2A
MEN2B
RET51
CDHF12
CDHR16
RET-ELE1

Gene

RET

PDB

4UX8   1XPD   2IVS   2IVT   2IVU   2IVV   2X2K   2X2L   2X2M   2X2U   4CKI   4CKJ   5AMN  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (1)

 CSPA Cell Line (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (599)

PMID Text
27349013 the frequency profile of RET mutations in the Azari population of Iran with Medullary thyroid carcinoma (MTC) is 61.7%.
27245001 after 20 years of the molecular and epidemiological research of RET/PTC in thyroid radiogenic carcinomas the comprehensive evidence of the dose-effect dependence existence indicating a real relationship between the studied parameters and radiation factor
27092013 Study shows that the RET nuclear expression was an independent predictor of renal clear cell carcinoma postoperative metastasis.
26933947 This study conducts miRNA profiling and shows disregulation of RET and its regulating signaling pathways in Hirschsprung's Disease patients.
26853422 Results suggest, a potential role for PIK3CA, VEGFR2, RET and FGFR2 as therapeutic targets in EGFR non-mutated NSCLC that requires further clinical validation.
26829565 The RET S836S polymorphism is in linkage disequilibrium with 3'UTR variants.
26823860 neither RAS mutation nor RET rearrangements were found to be associated with the clinicopathological characteristics of papillary thyroid cancer
26762747 RET gene rearrangement is associated with Lung Cancer.
26595521 Data show that heat shock protein 90 (HSP90) inhibitor 17-DMAG caused loss of ret proto-oncogene protein (RET) and proto-oncogene protein erbB-3 (ERBB3) phosphorylation and lead to rapid cell death.
26438242 MEN-PCC from India, the commonest causative RET mutations for MEN-PCC involved codon 634. MEN-PCC patients were younger, and more frequently had bilateral PCC than non-MEN disease.
More...

AA Sequence

MAKATSGAAGLRLLLLLLLPLLGKVALGLYFSRDAYWEKLYVDQAAGTPLLYVHALRDAPEEVPSFRLGQ      1 - 70
HLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLTVYLKVFLSPTSLREGECQWP     71 - 140
GCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENRPPGTFHQFRLLPVQFLCPNISVAYRLLEGE    141 - 210
GLPFRCAPDSLEVSTRWALDREQREKYELVAVCTVHAGAREEVVMVPFPVTVYDEDDSAPTFPAGVDTAS    211 - 280
AVVEFKRKEDTVVATLRVFDADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVRAT    281 - 350
VHDYRLVLNRNLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFA    351 - 420
QIGKVCVENCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAELHYMVVATDQ    421 - 490
QTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRLECEECGGLGSPTGRCEWRQGDGKGITRNFSTCSP    491 - 560
STKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPEDIQDPLC    561 - 630
DELCRTVIAAAVLFSFIVSVLLSAFCIHCYHKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSM    631 - 700
ENQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELR    701 - 770
DLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDH    771 - 840
PDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQ    841 - 910
GRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEM    911 - 980
YRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPR    981 - 1050
ALPSTWIENKLYGMSDPNWPGESPVPLTRADGTNTGFPRYPNDSVYANWMLSPSAAKLMDTFDS         1051 - 1114
//

Text Mined References (724)

PMID Year Title
27349013 2016 RET Gene Analysis in Patients with Medullary Thyroid Carcinoma.
27245001 [Dose-Response Dependences for Frequency of RET/PTC Gene Rearrangements in Papillary Thyroid Carcinoma after Irradiation. Simple Pooling Analysis of Molecular Epidemiological Data].
27092013 2016 Prognostic and Predictive Values of Subcellular Localisation of RET in Renal Clear-Cell Carcinoma.
26933947 2016 miRNA Profiling Reveals Dysregulation of RET and RET-Regulating Pathways in Hirschsprung's Disease.
26853422 Genomic profiling in a homogeneous molecular subtype of non-small cell lung cancer: An effort to explore new drug targets.
26829565 2016 Effect of 3'UTR RET Variants on RET mRNA Secondary Structure and Disease Presentation in Medullary Thyroid Carcinoma.
26823860 2015 Association between BRAF and RAS mutations, and RET rearrangements and the clinical features of papillary thyroid cancer.
26762747 2016 Clinicopathological Characteristics of RET Rearranged Lung Cancer in European Patients.
26595521 2016 HSP90 inhibition blocks ERBB3 and RET phosphorylation in myxoid/round cell liposarcoma and causes massive cell death in vitro and in vivo.
26438242 2016 Genotype-Phenotype Correlation in Indian Patients with MEN2-Associated Pheochromocytoma and Comparison of Clinico-Pathological Attributes with Apparently Sporadic Adrenal Pheochromocytoma.
More...