Property Summary

NCBI Gene PubMed Count 302
Grant Count 481
R01 Count 285
Funding $43,650,089.11
PubMed Score 659.29
PubTator Score 437.41

Knowledge Summary

Patent (59,678)

Expression

  Differential Expression (35)

Synonym

Accession P07948 A0AVQ5
Symbols JTK8
p53Lyn
p56Lyn

Gene

LYN

PDB

1W1F   1WA7   3A4O  

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Michael McManus Genetic interaction screen

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (124)

PMID Text
26708841 Authors discovered in this study that LYN was a critical gene. It was found to be the key nodule of several significant biological networks.
26517678 Inhibition of Lyn activity using dasatinib in mantle cell lymphoma overcomes bortezomib resistance.
26460485 SRC, LYN and CKB expression or DNA methylation could be useful markers for predicting tumor progression.
26308013 This study showed an interdependence between ROS generation and lipid rafts and Lyn relocation leading the cells to undergo the successive acrosome reaction.
26055819 positively regulates NF-kappaB transactivation through the phosphorylation of the p110 subunit of PI 3-kinase
25967238 Fyn, but not Lyn, was required for complete Pyk2 phosphorylation by thrombin.
25965880 Demonstrate role for CBL in the control of AXL/SYK/LYN network mediating resistance to nilotinib treatment in chronic myeloid leukemia cells.
25823815 Diminished Lyn levels impair Claudin-2 expression in breast cancer cells. The Lyn-selective kinase inhibitor, Bafetinib (INNO-406), reduces Claudin-2 expression and suppresses breast cancer liver metastasis.
25817574 Suggest an interrelated kinase module involving c-Raf/PI3K/Lyn and perhaps Fgr functions in a nontraditional way during retinoic acid-induced maturation or during rescue of RA induction therapy using inhibitor co-treatment in RA-resistant leukemia cells.
25418321 interaction between LacCer and Lyn in the lipid rafts of neutrophil-like cells
More...

AA Sequence

MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVA      1 - 70
LYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAE     71 - 140
RQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKH    141 - 210
YQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPG    211 - 280
TMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQ    281 - 350
IAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF    351 - 420
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTF    421 - 490
DYLQSVLDDFYTATEGQYQQQP                                                    491 - 512
//

Text Mined References (335)

PMID Year Title
26708841 2015 LYN, a Key Gene From Bioinformatics Analysis, Contributes to Development and Progression of Esophageal Adenocarcinoma.
26517678 2015 Inhibition of Lyn is a promising treatment for mantle cell lymphoma with bortezomib resistance.
26460485 2015 Deregulated Expression of SRC, LYN and CKB Kinases by DNA Methylation and Its Potential Role in Gastric Cancer Invasiveness and Metastasis.
26308013 2015 Astaxanthin Improves Human Sperm Capacitation by Inducing Lyn Displacement and Activation.
26055819 2015 Src-family-tyrosine kinase Lyn is critical for TLR2-mediated NF-?B activation through the PI 3-kinase signaling pathway.
25967238 2015 The focal adhesion kinase Pyk2 links Ca2+ signalling to Src family kinase activation and protein tyrosine phosphorylation in thrombin-stimulated platelets.
25965880 2015 CBL controls a tyrosine kinase network involving AXL, SYK and LYN in nilotinib-resistant chronic myeloid leukaemia.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25823815 2015 Lyn modulates Claudin-2 expression and is a therapeutic target for breast cancer liver metastasis.
25817574 2015 GW5074 and PP2 kinase inhibitors implicate nontraditional c-Raf and Lyn function as drivers of retinoic acid-induced maturation.
More...