Property Summary

Ligand Count 58
NCBI Gene PubMed Count 114
PubMed Score 103.63
PubTator Score 87.08

Knowledge Summary

Patent (12,192)

TINX Plot

  Disease (6)

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma 1.200 2.0e-21
Astrocytoma, Pilocytic 1.300 1.2e-07
atypical teratoid / rhabdoid tumor 1.300 7.4e-07
Breast cancer 3.800 2.2e-02
dermatomyositis 1.100 2.6e-03
Down syndrome 1.500 6.1e-04
ependymoma 1.500 2.2e-12
glioblastoma 1.300 1.3e-07
group 4 medulloblastoma 1.400 6.5e-04
invasive ductal carcinoma -1.233 2.3e-03
juvenile dermatomyositis 1.096 5.2e-11
medulloblastoma, large-cell 1.100 4.1e-02
oligodendroglioma 1.100 1.4e-08
osteosarcoma 1.606 5.0e-03
ovarian cancer 1.600 6.1e-03
pancreatic cancer -1.300 2.4e-02
pancreatic carcinoma -1.300 2.4e-02
pediatric high grade glioma 1.500 3.7e-06
primitive neuroectodermal tumor 1.200 1.3e-03
progressive supranuclear palsy -1.300 3.6e-02

Gene RIF (40)

AA Sequence

MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTP      1 - 70
FGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNG     71 - 140
YIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVK    141 - 210
HYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLE    211 - 280
VKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEF    281 - 350
MSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL    351 - 420
IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYR    421 - 490
MPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL                     491 - 543
//

Text Mined References (126)

PMID Year Title