Property Summary

NCBI Gene PubMed Count 108
Grant Count 32
R01 Count 18
Funding $2,860,496.78
PubMed Score 100.17
PubTator Score 87.08

Knowledge Summary

Patent (12,192)

Expression

  Differential Expression (20)

Disease log2 FC p
pancreatic cancer -1.300 0.024
astrocytoma 1.300 0.000
glioblastoma 1.700 0.000
oligodendroglioma 1.100 0.000
osteosarcoma 1.606 0.005
posterior fossa group A ependymoma 1.600 0.000
medulloblastoma 1.400 0.001
atypical teratoid / rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.100 0.041
primitive neuroectodermal tumor 1.200 0.001
juvenile dermatomyositis 1.096 0.000
Breast cancer 3.800 0.022
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.300 0.000
pancreatic carcinoma -1.300 0.024
invasive ductal carcinoma -1.233 0.002
progressive supranuclear palsy -1.300 0.036
ovarian cancer 1.600 0.006
Down syndrome 1.500 0.001
dermatomyositis 1.100 0.003

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
686946 summary 0 / 0 / 0 qHTS for small molecule inhibitors of Yes1 kinase: Summary
686947 confirmatory 361 / 116 / 381 qHTS for small molecule inhibitors of Yes1 kinase: Primary Screen
686948 confirmatory 17 / 0 / 0 qHTS for small molecule inhibitors of Yes1 kinase: Confirmatory screen on the cherrypicks

Gene RIF (38)

PMID Text
26676187 Up-regulation of miR-210 inhibits hepatocellular carcinoma cell proliferation. Yes1 is a target of miR-210 and affects cell proliferation in HCC.
25925378 Increased YES/SFK activation might serve as a clinical biomarker for predicting tumor resistance to IGF-1R inhibition.
25910964 findings indicate that miR-203 induces the apoptosis of KB cells by directly targeting Yes-1, suggesting its application in anti-cancer therapeutics
25868388 Results demonstrate a unique role for Yes in phosphorylation of FAK and in promoting PCa metastasis. Therefore, phosphorylated FAK Y861 and increased Yes expression may be predictive markers for PCa metastasis.
25561420 results indicated that miR-17-5p might play a role in human ovarian cancer by up-regulating YES1 expression.
24610809 YES kinase as a proximal glucose-specific signal in the Cdc42-signaling cascade.
24323901 YES1 and YAP transcript levels were higher in liver metastases of patients with colon cancer after 5FU-based neoadjuvant chemotherapy.
23898208 HIV-1 Tat downregulates the expression of v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1) in human primary T cells
23497302 Expression of HPV type 16 E7 resulted in increase in Src and Yes proteins level, but did not alter the level of Fyn.
23318429 we identified CRKL/YES as critical interrelated pathways necessary for rhabdomyosarcoma cell growth and survival and suggest a potential therapeutic role of SRC family kinase inhibition in the treatment of rhabdomyosarcoma.
More...

AA Sequence

MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTP      1 - 70
FGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNG     71 - 140
YIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVK    141 - 210
HYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLE    211 - 280
VKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEF    281 - 350
MSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL    351 - 420
IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYR    421 - 490
MPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL                     491 - 543
//

Text Mined References (121)

PMID Year Title
26676187 2015 Up-regulation of microRNA-210 inhibits proliferation of hepatocellular carcinoma cells by targeting YES1.
25925378 2015 IGF-1R Inhibition Activates a YES/SFK Bypass Resistance Pathway: Rational Basis for Co-Targeting IGF-1R and Yes/SFK Kinase in Rhabdomyosarcoma.
25910964 2015 miR-203 downregulates Yes-1 and suppresses oncogenic activity in human oral cancer cells.
25868388 2015 Yes-mediated phosphorylation of focal adhesion kinase at tyrosine 861 increases metastatic potential of prostate cancer cells.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25561420 2015 MiR-17-5p up-regulates YES1 to modulate the cell cycle progression and apoptosis in ovarian cancer cell lines.
25416956 2014 A proteome-scale map of the human interactome network.
24860872 2014 Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24610809 2014 YES, a Src family kinase, is a proximal glucose-specific activator of cell division cycle control protein 42 (Cdc42) in pancreatic islet ? cells.
More...