Property Summary

NCBI Gene PubMed Count 80
PubMed Score 80.58
PubTator Score 69.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.7
Liver cancer 604 0.0 0.8
Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 0.9
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 4C 9 3.713 1.9
Pierson syndrome 13 3.676 1.8
Disease Target Count
LISSENCEPHALY 5 1

Expression

  Differential Expression (31)

Disease log2 FC p
active Crohn's disease 1.578 7.1e-03
active ulcerative colitis 1.424 6.1e-03
acute myeloid leukemia -1.400 4.9e-02
acute quadriplegic myopathy 1.140 8.2e-04
Astrocytoma, Pilocytic 1.100 2.4e-02
autosomal dominant Emery-Dreifuss muscul... 1.470 4.3e-03
Breast cancer 1.100 4.3e-04
cystic fibrosis 1.200 2.2e-03
dermatomyositis 1.900 7.9e-03
diabetes mellitus -1.300 2.7e-02
Duchenne muscular dystrophy 2.009 2.2e-09
gastric carcinoma 1.400 3.7e-02
glioblastoma 1.300 6.4e-03
group 3 medulloblastoma 2.400 2.1e-05
intraductal papillary-mucinous adenoma (... -1.900 1.5e-02
intraductal papillary-mucinous neoplasm ... -1.600 4.2e-02
juvenile dermatomyositis 2.043 8.7e-12
lung adenocarcinoma -1.100 2.7e-04
lung carcinoma -1.400 1.8e-07
malignant mesothelioma -1.400 4.9e-07
medulloblastoma, large-cell 2.600 4.1e-04
nasopharyngeal carcinoma 2.800 3.9e-07
non primary Sjogren syndrome sicca 1.200 2.1e-02
oligodendroglioma -1.400 3.3e-02
ovarian cancer -4.400 2.3e-08
pancreatic cancer 1.400 2.8e-02
pediatric high grade glioma 1.400 9.4e-03
pituitary cancer -1.300 1.9e-02
primary pancreatic ductal adenocarcinoma 1.477 4.7e-02
psoriasis -1.400 1.6e-05
pterygium -1.100 2.2e-02

 OMIM Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (37)

AA Sequence

MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHL      1 - 70
QEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTF     71 - 140
KTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRAL    141 - 210
DPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASEC    211 - 280
APVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAV    281 - 350
YLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTG    351 - 420
LIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHC    421 - 490
DQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAE    491 - 560
EANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVIT    561 - 630
VQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTL    631 - 700
IDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTG    701 - 770
LACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQC    771 - 840
HCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGS    841 - 910
GDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHN    911 - 980
NIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKA    981 - 1050
TGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQEL   1051 - 1120
FWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVII   1121 - 1190
AELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDV   1191 - 1260
TEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLE   1261 - 1330
AEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGT   1331 - 1400
PPGASCSETECGGPNCRTDEGERKCGGPGCGGLVTVAHNAWQKAMDLDQDVLSALAEVEQLSKMVSEAKL   1401 - 1470
RADEAKQSAEDILLKTNATKEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQL   1471 - 1540
QNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAE   1541 - 1610
KAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVK   1611 - 1680
QSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDN   1681 - 1750
QRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL                                     1751 - 1786
//

Text Mined References (86)

PMID Year Title