Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.47
PubTator Score 8.98

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEE      1 - 70
LFDFLHARDHCVAHKLFNNLK                                                      71 - 91
//

Text Mined References (16)

PMID Year Title