Property Summary

NCBI Gene PubMed Count 122
Grant Count 40
R01 Count 17
Funding $5,311,773.34
PubMed Score 536.89
PubTator Score 306.22

Knowledge Summary

Patent

No data available

Gene RIF (95)

PMID Text
26811476 the crystal structures of polymerization regions of human UMOD and mouse ZP2, an essential sperm receptor protein that is structurally related to UMOD but forms heteropolymers, are reported.
26673890 These data demonstrate that the membrane-bound serine protease hepsin is the enzyme responsible for the physiological cleavage of uromodulin.
26617860 In essential hypertension there's a close negative relationship between lowered urine UMOD and increased serum inflammatory cytokines.
26040415 UMOD: A significant effect of the rare p.V458L variant on the value of estimated glomerular filtration in elderly population was found.
25935139 lower levels associated with nephrolithiasis
25840631 Uromodulin has greater immunosuppressive activities than THP and lower inductive property in relation to activation of immune cells.
25671765 The main and new finding of this study is the association of bilateral small caliber non-arteriosclerotic renal arteries with hyperuricemia due to a novel UMOD mutation causing intracellular accumulation of UMOD in distal tubular cells.
25493955 significantly associated with kidney function decline [meta-analysis]
25436415 Wild-type uromodulin was efficiently trafficked to the cell surface in transfected tsA 201 cells, whereas the mutants were partially retained within the cell, and incompletely processed
25163389 UMOD does not play a role in IgA nephropathy pathogenesis nor progression.
More...

AA Sequence

MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECA      1 - 70
IPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAG     71 - 140
YRGDGWHCECSPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLRGWYRFVGQGG    141 - 210
ARMAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPP    211 - 280
ECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQLK    281 - 350
SLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIK    351 - 420
INFACSYPLDMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLSTEAFLYVGTM    421 - 490
LDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQMFRFAGNYD    491 - 560
LVYLHCEVYLCDTMNEKCKPTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPLL    561 - 630
LSATLTLTFQ                                                                631 - 640
//

Text Mined References (124)

PMID Year Title
26811476 2016 A structured interdomain linker directs self-polymerization of human uromodulin.
26673890 2015 The serine protease hepsin mediates urinary secretion and polymerisation of Zona Pellucida domain protein uromodulin.
26617860 2015 Functional analysis of UMOD gene and its effect on inflammatory cytokines in serum of essential hypertension patients.
26040415 2015 Next generation sequencing search for uromodulin gene variants related with impaired renal function.
25935139 2015 An evaluation of Tamm-Horsfall protein glycans in kidney stone formers using novel techniques.
25840631 2015 Immunomodulatory properties of Tamm-Horsfall glycoprotein (THP) and uromodulin.
25671765 2015 Smaller caliber renal arteries are a novel feature of uromodulin-associated kidney disease.
25493955 2015 Genome-wide association study of kidney function decline in individuals of European descent.
25436415 2015 Pathogenic uromodulin mutations result in premature intracellular polymerization.
25163389 2014 UMOD polymorphism rs12917707 is not associated with severe or stable IgA nephropathy in a large Caucasian cohort.
More...