Property Summary

NCBI Gene PubMed Count 94
PubMed Score 109.93
PubTator Score 1349.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 4.4e-06
ovarian cancer 8520 5.5e-04
diabetes mellitus 1728 1.3e-03
group 3 medulloblastoma 4104 2.5e-03
acute myeloid leukemia 783 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 1.4

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia 1.300 1.4e-02
diabetes mellitus 2.600 1.3e-03
group 3 medulloblastoma 1.200 2.5e-03
osteosarcoma -1.609 4.4e-06
ovarian cancer 1.100 5.5e-04

 GWAS Trait (1)

Gene RIF (44)

AA Sequence

MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGE      1 - 70
DGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYP     71 - 140
ARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSL    141 - 210
LENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQL    211 - 280
ELIKDDEKEAEEGEDDRDSANGEDDS                                                281 - 306
//

Text Mined References (113)

PMID Year Title