Property Summary

NCBI Gene PubMed Count 85
Grant Count 209
R01 Count 152
Funding $26,630,792.49
PubMed Score 106.46
PubTator Score 1349.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.609 0.000
diabetes mellitus 2.600 0.001
group 3 medulloblastoma 1.200 0.003
acute myeloid leukemia 2.200 0.004
ovarian cancer 1.100 0.001

Synonym

Gene

PDB

3LN4   1TXP   1WF2   2MXY   2MZ1  

 GWAS Trait (1)

Gene RIF (42)

PMID Text
25890165 These findings suggest that hnRNP C1/C2 is involved in dengue virus replication at the stage of viral RNA synthesis.
25878250 Our results suggested that hnRNP C1 controls HPV16 late gene expression.
25719671 m(6)A-switch-regulated HNRNPC-binding activities affect the abundance as well as alternative splicing of target mRNAs, demonstrating the regulatory role of m(6)A-switches on gene expression and RNA maturation
25354590 HnRNP C, YB-1 and hnRNP L coordinately enhance skipping of human MUSK exon 10 to generate a Wnt-insensitive MuSK isoform.
24743263 PTBP1 and hnRNP C repress exon 3 inclusion, and that downregulation of PTBP1 inhibited BIM-mediated apoptosis.
23973260 down-regulation of MALAT-1 expression compromised the cytoplasmic translocation of hnRNP C in the G2/M phase and resulted in G2/M arrest
23585894 Heterogeneous nuclear ribonucleoprotein C is a key regulator of BRCA gene expression and homologous recombination-based DNA repair.
23374342 By preventing U2AF65 binding to Alu elements, hnRNP C plays a critical role as a genome-wide sentinel protecting the transcriptome.
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein C (HNRNPC), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein C (HNRNPC), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
More...

AA Sequence

MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGE      1 - 70
DGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYP     71 - 140
ARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSL    141 - 210
LENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQL    211 - 280
ELIKDDEKEAEEGEDDRDSANGEDDS                                                281 - 306
//

Text Mined References (103)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25890165 2015 Role of human heterogeneous nuclear ribonucleoprotein C1/C2 in dengue virus replication.
25878250 2015 Heterogeneous Nuclear Ribonucleoprotein C Proteins Interact with the Human Papillomavirus Type 16 (HPV16) Early 3'-Untranslated Region and Alleviate Suppression of HPV16 Late L1 mRNA Splicing.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25719671 2015 N(6)-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions.
25416956 2014 A proteome-scale map of the human interactome network.
25354590 2014 HnRNP C, YB-1 and hnRNP L coordinately enhance skipping of human MUSK exon 10 to generate a Wnt-insensitive MuSK isoform.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
More...