Property Summary

NCBI Gene PubMed Count 109
PubMed Score 221.83
PubTator Score 583.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Galactosemias 3 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Galactosemia 19 7.933 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.528 2.7e-05

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (67)

AA Sequence

MSRSGTDPQQRQQASEADAAAATFRANDHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQLLKTVPRHDP      1 - 70
LNPLCPGAIRANGEVNPQYDSTFLFDNDFPALQPDAPSPGPSDHPLFQAKSARGVCKVMCFHPWSDVTLP     71 - 140
LMSVPEIRAVVDAWASVTEELGAQYPWVQIFENKGAMMGCSNPHPHCQVWASSFLPDIAQREERSQQAYK    141 - 210
SQHGEPLLMEYSRQELLRKERLVLTSEHWLVLVPFWATWPYQTLLLPRRHVRRLPELTPAERDDLASIMK    211 - 280
KLLTKYDNLFETSFPYSMGWHGAPTGSEAGANWNHWQLHAHYYPPLLRSATVRKFMVGYEMLAQAQRDLT    281 - 350
PEQAAERLRALPEVHYHLGQKDRETATIA                                             351 - 379
//

Text Mined References (110)

PMID Year Title