Property Summary

Ligand Count 705
NCBI Gene PubMed Count 559
PubMed Score 4681.47
PubTator Score 2607.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Breast cancer 3.600 2.2e-02
cystic fibrosis and chronic rhinosinusit... -1.306 1.1e-02
juvenile dermatomyositis 1.084 1.9e-08
lung adenocarcinoma 2.082 8.7e-10
lung cancer 1.100 2.1e-03
medulloblastoma, large-cell 1.100 4.4e-04
Multiple myeloma 1.481 9.4e-04
non primary Sjogren syndrome sicca 1.300 2.4e-02
osteosarcoma 1.299 1.3e-04
ovarian cancer 2.700 8.1e-05
pancreatic cancer -1.200 4.5e-04
pancreatic carcinoma -1.200 4.5e-04
pancreatic ductal adenocarcinoma liver m... 1.050 1.7e-02
psoriasis 1.200 1.3e-03
Waldenstrons macroglobulinemia 1.386 1.7e-02

Protein-protein Interaction (2)

PDB (224)

Gene RIF (382)

AA Sequence

MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKL      1 - 70
DSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYS     71 - 140
AYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKH    141 - 210
SQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKI    211 - 280
KEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFD    281 - 350
LFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC    351 - 420
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKH    421 - 490
IYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKK    491 - 560
QEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAA    561 - 630
KKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDE    631 - 700
DDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD                                          701 - 732
//

Text Mined References (586)

PMID Year Title