Property Summary

NCBI Gene PubMed Count 515
PubMed Score 4395.51
PubTator Score 2607.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession P07900 A8K500 B3KPJ9 Q2PP14 Q5CAQ6 Q5CAQ7 Q9BVQ5
Symbols EL52
HSPN
LAP2
HSP86
HSPC1
HSPCA
Hsp89
Hsp90
LAP-2
HSP89A
HSP90A
HSP90N
Hsp103
HSPCAL1
HSPCAL4
HEL-S-65p

Gene

PANTHER Protein Class (2)

PDB

4AIF   4CGV   4CGW   2K5B   2BUG   1BYQ   1OSF   1UY6   1UY7   1UY8   1UY9   1UYC   1UYD   1UYE   1UYF   1UYG   1UYH   1UYI   1UYK   1UYL   1YC1   1YC3   1YC4   1YER   1YES   1YET   2BSM   2BT0   2BYH   2BYI   2BZ5   2C2L   2CCS   2CCT   2CCU   2FWY   2FWZ   2H55   2JJC   2QF6   2QFO   2QG0   2QG2   2UWD   2VCI   2VCJ   2WI1   2WI2   2WI3   2WI4   2WI5   2WI6   2WI7   2XAB   2XDK   2XDL   2XDS   2XDU   2XDX   2XHR   2XHT   2XHX   2XJG   2XJJ   2XJX   2XK2   2YE2   2YE3   2YE4   2YE5   2YE6   2YE7   2YE8   2YE9   2YEA   2YEB   2YEC   2YED   2YEE   2YEF   2YEG   2YEH   2YEI   2YEJ   2YI0   2YI5   2YI6   2YI7   2YJW   2YJX   2YK2   2YK9   2YKB   2YKC   2YKE   2YKI   2YKJ   3B24   3B25   3B26   3B27   3B28   3BM9   3BMY   3D0B   3EKO   3EKR   3FT5   3FT8   3HEK   3HHU   3HYY   3HYZ   3HZ1   3HZ5   3INW   3INX   3K97   3K98   3K99   3MNR   3O0I   3OW6   3OWB   3OWD   3Q6M   3Q6N   3QDD   3QTF   3R4M   3R4N   3R4O   3R4P   3R91   3R92   3RKZ   3RLP   3RLQ   3RLR   3T0H   3T0Z   3T10   3T1K   3T2S   3TUH   3VHA   3VHC   3VHD   3WHA   3WQ9   4AWO   4AWP   4AWQ   4B7P   4BQG   4BQJ   4CGQ   4CGU   4CWF   4CWN   4CWO   4CWP   4CWQ   4CWR   4CWS   4CWT   4EEH   4EFT   4EFU   4EGH   4EGI   4EGK   4FCP   4FCQ   4FCR   4HY6   4JQL   4L8Z   4L90   4L91   4L93   4L94   4LWE   4LWF   4LWG   4LWH   4LWI   4NH7   4NH8   4O04   4O05   4O07   4O09   4O0B   4R3M   4U93   4W7T   4XIP   4XIQ   4XIR   4XIT   4YKQ   4YKR   4YKT   4YKU   4YKW   4YKX   4YKY   4YKZ   5CF0  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
540270 confirmatory 896 / 0 / 34 HsHsp90 Counterscreen Measured in Microorganism System Using Plate Reader - 2121-02_Inhibitor_Dose_CherryPick_Activity
588404 confirmatory 7 / 8 / 2 HsHsp90 Counterscreen Measured in Microorganism System Using Plate Reader - 2121-02_Inhibitor_Dose_DryPowder_Activity
602161 confirmatory 6 / 1 / 0 PfHsp90: GR reporter assay HsHsp90 Measured in Microorganism System Using Plate Reader - 2121-04_Inhibitor_Dose_DryPowder_Activity

Gene RIF (355)

PMID Text
26982469 The region of aa 250-295 of BGLF4 is essential for the BGLF4/Hsp90 interaction.
26884463 Aarsd1 inhibits the activity of a paradigmatic Hsp90 client protein.
26808260 In conjunction with HSP90, the cytoplasmic USP19 may play a key role in triage decision for the disease-related polyQ-expanded substrates, suggesting a function of USP19 in quality control of misfolded proteins by regulating their protein levels
26782567 Three of the differentially expressed heat-schock proteins, HSP90A, HSPB1, and HSPB2, are up-regulated in giant cell tumor of bone patients.
26704341 The expression of HSP90A was increased in the HCC cells, serum, and tissues. Immunohistochemistry analysis on 76 clinical tissue samples also suggested the relevance between HSP90A expression and HCC metastatic behavior.
26616658 study confirmed Hsp90 as an influenza virus A PB2 polymerase interacting protein, and established that Hsp90 interacts with both the E627 and 627K variants, but has established this interaction is species independent, and both mammalian and avian Hsp90 can bind to the PB2 protein
26595521 Data show that heat shock protein 90 (HSP90) inhibitor 17-DMAG caused loss of ret proto-oncogene protein (RET) and proto-oncogene protein erbB-3 (ERBB3) phosphorylation and lead to rapid cell death.
26565746 Both intrinsic affinity and post-translational modifications tune the interactions between the Hsp70 and Hsp90 proteins and the tetratricopeptide repeat (TPR) domain-containing cochaperones.
26556860 Data suggest that synergistic mechanism between heat shock protein 90 (Hsp90) inhibitor SNX-7081 and fludarabine nucleoside (2-FaraA) may provide an alternative treatment for chronic lymphocytic leukemia (CLL) patients with p53 protein mutations.
26556859 Data suggest that dual heat shock proteins HSP90 and HSP70 inhibition can simultaneously disrupt the key signaling pathways in muscle invasive bladder cancer (MIBC).
More...

AA Sequence

MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKL      1 - 70
DSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYS     71 - 140
AYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKH    141 - 210
SQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKI    211 - 280
KEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFD    281 - 350
LFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC    351 - 420
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKH    421 - 490
IYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKK    491 - 560
QEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAA    561 - 630
KKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDE    631 - 700
DDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD                                          701 - 732
//

Text Mined References (539)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
26982469 2016 The split Renilla luciferase complementation assay is useful for identifying the interaction of Epstein-Barr virus protein kinase BGLF4 and a heat shock protein Hsp90.
26884463 2016 A Remodeled Hsp90 Molecular Chaperone Ensemble with the Novel Cochaperone Aarsd1 Is Required for Muscle Differentiation.
26808260 2016 Cytoplasmic Ubiquitin-Specific Protease 19 (USP19) Modulates Aggregation of Polyglutamine-Expanded Ataxin-3 and Huntingtin through the HSP90 Chaperone.
26782567 2015 Potential role of heat-shock proteins in giant cell tumors.
26704341 2015 Transcriptomic and Proteomic Investigation of HSP90A as a Potential Biomarker for HCC.
26616658 2015 Identification of Hsp90 as a species independent H5N1 avian influenza A virus PB2 interacting protein.
26595521 2016 HSP90 inhibition blocks ERBB3 and RET phosphorylation in myxoid/round cell liposarcoma and causes massive cell death in vitro and in vivo.
26565746 2015 Specific Binding of Tetratricopeptide Repeat Proteins to Heat Shock Protein 70 (Hsp70) and Heat Shock Protein 90 (Hsp90) Is Regulated by Affinity and Phosphorylation.
26556860 2015 The Hsp90 inhibitor SNX-7081 is synergistic with fludarabine nucleoside via DNA damage and repair mechanisms in human, p53-negative chronic lymphocytic leukemia.
More...