Property Summary

Ligand Count 701
NCBI Gene PubMed Count 559
PubMed Score 4681.47
PubTator Score 2607.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Breast cancer 3.600 2.2e-02
cystic fibrosis and chronic rhinosinusit... -1.306 1.1e-02
juvenile dermatomyositis 1.084 1.9e-08
lung adenocarcinoma 2.082 8.7e-10
lung cancer 1.100 2.1e-03
medulloblastoma, large-cell 1.100 4.4e-04
Multiple myeloma 1.481 9.4e-04
non primary Sjogren syndrome sicca 1.300 2.4e-02
osteosarcoma 1.299 1.3e-04
ovarian cancer 2.700 8.1e-05
pancreatic cancer -1.200 4.5e-04
pancreatic carcinoma -1.200 4.5e-04
pancreatic ductal adenocarcinoma liver m... 1.050 1.7e-02
psoriasis 1.200 1.3e-03
Waldenstrons macroglobulinemia 1.386 1.7e-02

Synonym

Accession P07900 A8K500 B3KPJ9 Q2PP14 Q5CAQ6 Q5CAQ7 Q9BVQ5
Symbols EL52
HSPN
LAP2
HSP86
HSPC1
HSPCA
Hsp89
Hsp90
LAP-2
HSP89A
HSP90A
HSP90N
Hsp103
HSPCAL1
HSPCAL4
HEL-S-65p

Gene

PANTHER Protein Class (2)

PDB

4AIF   4CGV   4CGW   2K5B   2BUG   1BYQ   1OSF   1UY6   1UY7   1UY8   1UY9   1UYC   1UYD   1UYE   1UYF   1UYG   1UYH   1UYI   1UYK   1UYL   1YC1   1YC3   1YC4   1YER   1YES   1YET   2BSM   2BT0   2BYH   2BYI   2BZ5   2C2L   2CCS   2CCT   2CCU   2FWY   2FWZ   2H55   2JJC   2QF6   2QFO   2QG0   2QG2   2UWD   2VCI   2VCJ   2WI1   2WI2   2WI3   2WI4   2WI5   2WI6   2WI7   2XAB   2XDK   2XDL   2XDS   2XDU   2XDX   2XHR   2XHT   2XHX   2XJG   2XJJ   2XJX   2XK2   2YE2   2YE3   2YE4   2YE5   2YE6   2YE7   2YE8   2YE9   2YEA   2YEB   2YEC   2YED   2YEE   2YEF   2YEG   2YEH   2YEI   2YEJ   2YI0   2YI5   2YI6   2YI7   2YJW   2YJX   2YK2   2YK9   2YKB   2YKC   2YKE   2YKI   2YKJ   3B24   3B25   3B26   3B27   3B28   3BM9   3BMY   3D0B   3EKO   3EKR   3FT5   3FT8   3HEK   3HHU   3HYY   3HYZ   3HZ1   3HZ5   3INW   3INX   3K97   3K98   3K99   3MNR   3O0I   3OW6   3OWB   3OWD   3Q6M   3Q6N   3QDD   3QTF   3R4M   3R4N   3R4O   3R4P   3R91   3R92   3RKZ   3RLP   3RLQ   3RLR   3T0H   3T0Z   3T10   3T1K   3T2S   3TUH   3VHA   3VHC   3VHD   3WHA   3WQ9   4AWO   4AWP   4AWQ   4B7P   4BQG   4BQJ   4CGQ   4CGU   4CWF   4CWN   4CWO   4CWP   4CWQ   4CWR   4CWS   4CWT   4EEH   4EFT   4EFU   4EGH   4EGI   4EGK   4FCP   4FCQ   4FCR   4HY6   4JQL   4L8Z   4L90   4L91   4L93   4L94   4LWE   4LWF   4LWG   4LWH   4LWI   4NH7   4NH8   4O04   4O05   4O07   4O09   4O0B   4R3M   4U93   4W7T   4XIP   4XIQ   4XIR   4XIT   4YKQ   4YKR   4YKT   4YKU   4YKW   4YKX   4YKY   4YKZ   5CF0   5FNC   5FND   5FNF   5GGZ   5J2V   5LQ9   5LR1   5LR7   5LRL   5LRZ   5LS1   5M4E   5M4H   5T21  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (2)

Gene RIF (382)

AA Sequence

MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKL      1 - 70
DSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYS     71 - 140
AYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKH    141 - 210
SQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKI    211 - 280
KEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFD    281 - 350
LFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC    351 - 420
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKH    421 - 490
IYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKK    491 - 560
QEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAA    561 - 630
KKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDE    631 - 700
DDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD                                          701 - 732
//

Text Mined References (586)

PMID Year Title