Property Summary

NCBI Gene PubMed Count 29
Grant Count 19
R01 Count 8
Funding $3,775,633.92
PubMed Score 505.48
PubTator Score 235.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.044 0.000
head and neck cancer 1.200 0.028

Gene RIF (10)

PMID Text
26503549 three uniquely identified proteins (CDK6 , galectin-3-binding protein and LDH C) were found, which show tight connection with prostate cancer and presence of all of them was previously linked to certain aspects of prostate cancer
26069337 This is the first report to show a positive correlation between LDH-3 and hemolytic parameters in sickle cell anemia.
25795631 Down-regulated LDH-C4 expression is significantly correlated with lowered enzyme activity in human spermatozoa.
21858537 Results show that S-100B, MIA and LDH levels were significantly higher in patients with advanced melanoma than in disease-free patients or healthy controls.
20499337 Elevated serum LDH isoenzymes and AST indicate a disturbance (of uncertain clinical significance) within multiple extraosseous tissues when there is CLCN7 deficiency.
18930904 hLdhc expression in cancer cells was regulated by transcription factor Sp1 and CREB and promoter CGI methylation
17935709 LDH3 is a supporting diagnostic marker in cases of chronic tuberculosis.
17178662 LDH3 was increased in essential thrombocythemia. This isoenzymatic pattern could be expression of a metabolic adaptation.
11582518 A lentivirus lytic peptide 1 (LLP-1) corresponding to the carboxyl terminus of HIV-1 gp41 induces a significant lactate dehydrogenase (LDH, a marker of cell death) release from human neuronal and glial cell lines
11125887 A lentivirus lytic peptide 1 (LLP-1) corresponding to the carboxyl terminus of HIV-1 gp41 induces a significant lactate dehydrogenase (LDH, a marker of cell death) release from human neuronal and glial cell lines

AA Sequence

MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSL      1 - 70
FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV     71 - 140
DILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVA    141 - 210
LKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGL    211 - 280
YGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF                      281 - 332
//

Text Mined References (30)

PMID Year Title
26503549 2015 Differences in urinary proteins related to surgical margin status after radical prostatectomy.
26069337 2015 Lactate dehydrogenase isoenzyme 3 and hemolysis in sickle cell anemia: a possible correlation?
25795631 2015 Quick histochemical staining method for measuring lactate dehydrogenase C4 activity in human spermatozoa.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21858537 2011 Evaluation of multiple serum markers in advanced melanoma.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21124955 2010 Genome-wide association study identifies two novel regions at 11p15.5-p13 and 1p31 with major impact on acute-phase serum amyloid A.
20499337 2010 Elevated serum lactate dehydrogenase isoenzymes and aspartate transaminase distinguish Albers-Schönberg disease (Chloride Channel 7 Deficiency Osteopetrosis) among the sclerosing bone disorders.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...