Property Summary

Ligand Count 480
NCBI Gene PubMed Count 286
PubMed Score 5011.47
PubTator Score 2020.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Myopathy 185
Renal Cell Carcinoma 214
Disease Target Count
Chronic hepatitis C 12
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Parkinson's disease 392 0.0 1.7

Expression

  Differential Expression (23)

Disease log2 FC p
glioblastoma 2.400 1.1e-03
acute quadriplegic myopathy 1.021 1.1e-04
astrocytoma 1.500 2.5e-02
atypical teratoid / rhabdoid tumor -1.100 6.5e-04
breast carcinoma 2.400 2.3e-03
cutaneous lupus erythematosus 1.200 2.1e-03
cystic fibrosis 1.242 8.8e-06
Duchenne muscular dystrophy 1.102 3.2e-06
gastric carcinoma 1.900 3.4e-02
group 3 medulloblastoma -1.200 6.4e-03
inflammatory breast cancer 1.700 3.1e-06
intraductal papillary-mucinous neoplasm ... 1.200 3.0e-02
invasive ductal carcinoma 1.676 1.9e-05
juvenile dermatomyositis 1.248 2.2e-09
lung cancer -1.100 1.1e-03
lung carcinoma -1.100 2.9e-14
malignant mesothelioma -1.100 2.9e-06
medulloblastoma, large-cell -1.100 6.5e-04
osteosarcoma 2.614 1.9e-04
ovarian cancer -1.100 6.7e-03
pancreatic cancer 1.100 1.7e-03
pancreatic ductal adenocarcinoma liver m... 1.696 3.5e-02
subependymal giant cell astrocytoma 1.917 3.2e-02

Gene RIF (212)

AA Sequence

MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQ      1 - 70
RVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLT     71 - 140
CCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKI    141 - 210
CEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAI    211 - 280
RILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI               281 - 339
//

Text Mined References (289)

PMID Year Title