Property Summary

NCBI Gene PubMed Count 267
Grant Count 532
R01 Count 228
Funding $236,829,901.72
PubMed Score 4405.48
PubTator Score 2020.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P07858 B3KQR5 B3KRR5 Q503A6 Q96D87
Symbols APPS
CPSB

Gene

PANTHER Protein Class (3)

PDB

3K9M   1CSB   1GMY   1HUC   1PBH   2IPP   2PBH   3AI8   3CBJ   3CBK   3PBH  

Gene RIF (192)

PMID Text
27031837 Cathepsin B knockdown in oral cancer cells reduces cell migration.
26904684 High activity of cathepsin B and increased level of cystatin C are typical for women in late pregnancy. Those levels significantly decrease after delivery which can be associated with potential role of those markers in placental separation
26896959 CTSB might be involved in the development and progression of hepatocellular carcinoma.
26081835 shedding of surface proteins by extracellular cathepsins impacts intracellular signaling as demonstrated for regulation of Ras GTPase activity.
25991043 The serum level of cathepsin L decreased with age, while cathepsin B remained no significant difference between young and aged individuals
25959927 the authors applied the technique of nanoelectrode arrays to try to detect and compare cathepsin B activities in normal and breast cancer cells. It was found that protease activity correlated positively with the degree of malignancy cancer cells.
25883214 High cathepsin is associated with drug resistance in neuroblastoma.
25802234 SCD5 impairs SPARC and cathepsin B secretion in human melanoma cells and intracellular pH acidification.
25633482 Cathepsins B and L activity correlates with the efficiency of reovirus-mediated tumor cell killing.
25577554 enhanced activity and expression of cathepsin B contributes to an increased remodelling of extracellular matrix that favours leiomyoma growth
More...

AA Sequence

MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQ      1 - 70
RVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLT     71 - 140
CCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKI    141 - 210
CEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAI    211 - 280
RILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI               281 - 339
//

Text Mined References (270)

PMID Year Title
27031837 2016 Cathepsin B Expression and the Correlation with Clinical Aspects of Oral Squamous Cell Carcinoma.
26904684 2016 Activity of Proteolytic Enzymes and Level of Cystatin C in the Peripartum Period.
26896959 2016 Over-expression of cathepsin B in hepatocellular carcinomas predicts poor prognosis of HCC patients.
26081835 2015 Proteomic Identification of Cysteine Cathepsin Substrates Shed from the Surface of Cancer Cells.
25991043 Differential levels of cathepsin B and L in serum between young and aged healthy people and their association with matrix metalloproteinase 2.
25959927 2015 Quantitative electrochemical detection of cathepsin B activity in breast cancer cell lysates using carbon nanofiber nanoelectrode arrays toward identification of cancer formation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25883214 2015 Inhibition of cathepsin proteases attenuates migration and sensitizes aggressive N-Myc amplified human neuroblastoma cells to doxorubicin.
25802234 2015 SCD5-induced oleic acid production reduces melanoma malignancy by intracellular retention of SPARC and cathepsin B.
25633482 2015 Activity levels of cathepsins B and L in tumor cells are a biomarker for efficacy of reovirus-mediated tumor cell killing.
More...