Property Summary

NCBI Gene PubMed Count 33
Grant Count 544
R01 Count 296
Funding $153,385,428.42
PubMed Score 1189.81
PubTator Score 44.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.316 0.001
oligodendroglioma 1.100 0.035
psoriasis 1.500 0.000
osteosarcoma 2.313 0.000
ependymoma 1.200 0.001
medulloblastoma 1.700 0.001
astrocytoma 1.100 0.007
atypical teratoid / rhabdoid tumor 1.800 0.000
glioblastoma 2.000 0.000
medulloblastoma, large-cell 3.000 0.000
primitive neuroectodermal tumor 1.600 0.000
non-small cell lung cancer 1.326 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.009
intraductal papillary-mucinous carcinoma... 1.100 0.003
lung cancer 2.100 0.000
Breast cancer 2.500 0.031
pediatric high grade glioma 1.400 0.001
lung adenocarcinoma 1.199 0.000
invasive ductal carcinoma 1.200 0.011
ovarian cancer 2.600 0.000
Gaucher disease type 1 -1.500 0.023
pancreatic cancer -1.200 0.003

Synonym

Accession P07814 A0AVA9 B9EGH3 Q05BP6 Q05DF8 Q5DSM1 Q5H9S5 Q6PD57 Q86X73
Symbols EARS
PARS
QARS
QPRS
PIG32
GLUPRORS

Gene

PANTHER Protein Class (1)

PDB

5BMU   1FYJ   4HVC   4K86   4K87   4K88   5A1N   5A34   5A5H  

Gene RIF (14)

PMID Text
26472928 analysis of the heterotetrameric complex structure of the glutathione transferase (GST) domains shared among the four MSC components, methionyl-tRNA synthetase (MRS), glutaminyl-prolyl-tRNA synthetase (EPRS), AIMP2 and AIMP3
25631074 Cellular biotinylated glutamyl-prolyl-tRNA synthetase (EPRS, Bifunctional glutamate/proline tRNA ligase) protein is incorporated into HIV-1 Gag virus-like particles
25010285 Cellular biotinylated glutamyl-prolyl-tRNA synthetase (EPRS, Bifunctional glutamate/proline tRNA ligase) protein is incorporated into HIV-1 Gag virus-like particles
23125841 Cellular biotinylated glutamyl-prolyl-tRNA synthetase (EPRS, Bifunctional glutamate/proline tRNA ligase) protein is incorporated into HIV-1 Gag virus-like particles
23125841 Cellular biotinylated glutamyl-prolyl-tRNA synthetase (EPRS, Bifunctional glutamate/proline tRNA ligase) protein is incorporated into HIV-1 Gag virus-like particles
23125841 Cellular biotinylated glutamyl-prolyl-tRNA synthetase (EPRS, Bifunctional glutamate/proline tRNA ligase) protein is incorporated into HIV-1 Gag virus-like particles
23125841 Cellular biotinylated glutamyl-prolyl-tRNA synthetase (EPRS, Bifunctional glutamate/proline tRNA ligase) protein is incorporated into HIV-1 Gag virus-like particles
22386318 Dynamic model simulations predicted an inhibitory GAIT-element-interacting factor to account for this relationship and led to the identification of a truncated form of EPRS, a GAIT constituent that mediates binding to target transcripts.
22190034 Cellular biotinylated glutamyl-prolyl-tRNA synthetase (EPRS, Bifunctional glutamate/proline tRNA ligase) protein is incorporated into HIV-1 Gag virus-like particles
21220307 Study reveals a unique role of Cdk5/p35 in activation of the major noncanonical function of EPRS, namely translational control of macrophage inflammatory gene expression.
More...

AA Sequence

MATLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGS      1 - 70
NLMEHTEIDHWLEFSATKLSSCDSFTSTINELNHCLSLRTYLVGNSLSLADLCVWATLKGNAAWQEQLKQ     71 - 140
KKAPVHVKRWFGFLEAQQAFQSVGTKWDVSTTKARVAPEKKQDVGKFVELPGAEMGKVTVRFPPEASGYL    141 - 210
HIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYA    211 - 280
EKLIQEGKAYVDDTPAEQMKAEREQRIDSKHRKNPIEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGC    281 - 350
MRDPTLYRCKIQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYI    351 - 420
WEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWD    421 - 490
KIWAFNKKVIDPVAPRYVALLKKEVIPVNVPEAQEEMKEVAKHPKNPEVGLKPVWYSPKVFIEGADAETF    491 - 560
SEGEMVTFINWGNLNITKIHKNADGKIISLDAKLNLENKDYKKTTKVTWLAETTHALPIPVICVTYEHLI    561 - 630
TKPVLGKDEDFKQYVNKNSKHEELMLGDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCVLI    631 - 700
YIPDGHTKEMPTSGSKEKTKVEATKNETSAPFKERPTPSLNNNCTTSEDSLVLYNRVAVQGDVVRELKAK    701 - 770
KAPKEDVDAAVKQLLSLKAEYKEKTGQEYKPGNPPAEIGQNISSNSSASILESKSLYDEVAAQGEVVRKL    771 - 840
KAEKSPKAKINEAVECLLSLKAQYKEKTGKEYIPGQPPLSQSSDSSPTRNSEPAGLETPEAKVLFDKVAS    841 - 910
QGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKKKEKENKSEKQNKPQK    911 - 980
QNDGQRKDPSKNQGGGLSSSGAGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILR    981 - 1050
PWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRP   1051 - 1120
TSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQIL   1121 - 1190
DLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPK   1191 - 1260
IPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDY   1261 - 1330
RRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETK   1331 - 1400
LQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPG   1401 - 1470
APSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY                               1471 - 1512
//

Text Mined References (51)

PMID Year Title
26472928 2015 Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24337748 2014 Guanylate binding protein 1-mediated interaction of T cell antigen receptor signaling with the cytoskeleton.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23071094 2012 Heterotrimeric GAIT complex drives transcript-selective translation inhibition in murine macrophages.
22386318 2012 Coding region polyadenylation generates a truncated tRNA synthetase that counters translation repression.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...