Property Summary

NCBI Gene PubMed Count 100
Grant Count 63
R01 Count 17
Funding $4,877,639.99
PubMed Score 160.13
PubTator Score 193.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 2.400 0.001
glioblastoma 1.100 0.004
lung cancer -1.400 0.001
adult high grade glioma 1.200 0.001
lung carcinoma -1.800 0.000
ovarian cancer 1.100 0.000
psoriasis 1.200 0.000

Synonym

Accession P07766 A8K997
Symbols T3E
TCRE
IMD18

Gene

PDB

1SY6   1A81   1XIW   2ROL  

Gene RIF (85)

PMID Text
26888626 increase. Our results indicate that the change in CD3zeta-chain expression from the baseline is an independent predictor of residual and recurrent head and neck squamous cell carcinoma.
26828096 Data suggest that HIV-1 gp41 transmembrane domain (TMD) directly interacts with TMDs of the T-cell receptor and it's CD3-antigen co-receptors (delta, gamma, and epsilon); these interactions appear to be involved in immune evasion mechanism of HIV-1.
26109064 The docking site for CD3 subunits on the T Cell receptor beta chain has been identified by solution NMR.
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of CD3E against production of infectious wild-type HIV-1
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of CD3E against production of infectious wild-type HIV-1
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of CD3E against production of infectious wild-type HIV-1
25505066 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of CD3E against production of infectious wild-type HIV-1
25467409 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of CD3E against production of infectious wild-type HIV-1
25467409 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of CD3E against production of infectious wild-type HIV-1
25422432 analysis of the molecular organization of the TCR-CD3 complex
More...

AA Sequence

MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDE      1 - 70
DDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICI     71 - 140
TGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI       141 - 207
//

Text Mined References (104)

PMID Year Title
26888626 2016 Change in CD3?-chain expression is an independent predictor of disease status in head and neck cancer patients.
26828096 2016 The Transmembrane Domain of HIV-1 gp41 Inhibits T-Cell Activation by Targeting Multiple T-Cell Receptor Complex Components through Its GxxxG Motif.
26109064 2015 Identification of the Docking Site for CD3 on the T Cell Receptor ? Chain by Solution NMR.
25422432 2014 Molecular architecture of the ?? T cell receptor-CD3 complex.
24470497 2014 Relevance of Nck-CD3 epsilon interaction for T cell activation in vivo.
23817958 2013 Proinflammatory stimuli induce galectin-9 in human mesenchymal stromal cells to suppress T-cell proliferation.
23216707 2013 Do drug transporter (ABCB1) SNPs and P-glycoprotein function influence cyclosporine and macrolides exposure in renal transplant patients? Results of the pharmacogenomic substudy within the symphony study.
23166358 2012 Local changes in lipid environment of TCR microclusters regulate membrane binding by the CD3? cytoplasmic domain.
22401598 2012 Altered expression of the TCR signaling related genes CD3 and Fc?RI? in patients with aplastic anemia.
21980389 2011 Tumor site immune markers associated with risk for subsequent basal cell carcinomas.
More...