Property Summary

Ligand Count 2
NCBI Gene PubMed Count 104
PubMed Score 172.57
PubTator Score 193.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.200 7.0e-04
cutaneous lupus erythematosus 2.400 8.1e-04
glioblastoma 1.100 4.0e-03
lung cancer -1.400 1.5e-03
lung carcinoma -1.800 5.6e-13
ovarian cancer 1.100 2.5e-08
psoriasis 1.200 2.7e-41

Protein-protein Interaction (8)

Gene RIF (73)

AA Sequence

MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDE      1 - 70
DDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICI     71 - 140
TGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI       141 - 207
//

Text Mined References (112)

PMID Year Title