Property Summary

NCBI Gene PubMed Count 48
PubMed Score 229.37
PubTator Score 504.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 8.7e-05
lung cancer 1.100 7.6e-03
medulloblastoma, large-cell 1.300 1.5e-03
osteosarcoma -1.940 2.8e-06
tuberculosis 1.100 7.3e-09

Protein-protein Interaction (2)

Gene RIF (9)

AA Sequence

MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFL      1 - 70
FGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAAC     71 - 140
ELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE                                  141 - 180
//

Text Mined References (58)

PMID Year Title