Property Summary

NCBI Gene PubMed Count 23
PubMed Score 17.94
PubTator Score 63.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
osteosarcoma -2.216 0.005
cystic fibrosis -1.350 0.000
tuberculosis and treatment for 3 months -1.200 0.000
lung cancer 1.200 0.001
pancreatic cancer 1.100 0.000
spina bifida -2.647 0.044
mucosa-associated lymphoid tissue lympho... 1.601 0.037
ovarian cancer 1.800 0.000

Synonym

Accession P07738 A4D1N9 BPGM
Symbols DPGM

Gene

PDB

1T8P   2A9J   2F90   2H4X   2H4Z   2H52   2HHJ   3NFY  

Gene RIF (3)

PMID Text
21045285 1.94 A resolution X-ray structure of bisphosphoglycerate mutase is presented, focusing on the dynamic nature of key ligand-binding residues and their interaction with the inhibitor citrate
17052986 analysis of histidine phosphorylation in human bisphosphoglycerate mutase
15258155 bisphosphoglycerate mutase crystallographic structure

AA Sequence

MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLI      1 - 70
LEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDR     71 - 140
RYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINI    141 - 210
TLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK                         211 - 259
//

Text Mined References (30)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21045285 2010 Unliganded structure of human bisphosphoglycerate mutase reveals side-chain movements induced by ligand binding.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17052986 2006 Seeing the process of histidine phosphorylation in human bisphosphoglycerate mutase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16246416 2006 Novel placental expression of 2,3-bisphosphoglycerate mutase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...