Property Summary

NCBI Gene PubMed Count 23
PubMed Score 18.36
PubTator Score 63.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cystic fibrosis -1.350 3.5e-05
lung cancer 1.200 1.4e-03
malignant mesothelioma -1.200 7.7e-06
mucosa-associated lymphoid tissue lympho... 1.601 3.7e-02
osteosarcoma -2.216 4.6e-03
ovarian cancer 1.800 2.6e-04
pancreatic cancer 1.100 6.0e-05
spina bifida -2.647 4.4e-02
tuberculosis and treatment for 3 months -1.200 1.0e-04

Protein-protein Interaction (3)

Gene RIF (3)

AA Sequence

MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLI      1 - 70
LEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDR     71 - 140
RYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINI    141 - 210
TLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK                         211 - 259
//

Text Mined References (30)

PMID Year Title