Property Summary

NCBI Gene PubMed Count 115
PubMed Score 199.62
PubTator Score 159.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.16848812296333E-9
acute quadriplegic myopathy 1157 1.43663010165542E-7
glioblastoma 5572 2.11170188260203E-7
pediatric high grade glioma 2712 2.78217763415369E-7
ovarian cancer 8492 9.98571392853743E-7
lung adenocarcinoma 2714 1.25625149674983E-6
pilocytic astrocytoma 3086 5.98405097172354E-6
Becker muscular dystrophy 187 5.04255895122259E-5
medulloblastoma, large-cell 6234 2.44963116829424E-4
primitive neuroectodermal tumor 3031 2.6060012606876E-4
psoriasis 6685 3.30569235293112E-4
medulloblastoma 1524 4.75900864605183E-4
astrocytoma 1493 0.00126583872045312
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00174310504643215
Rheumatoid Arthritis 1171 0.00187024935031174
Multiple myeloma 1328 0.00256901986620677
Waldenstrons macroglobulinemia 765 0.00536191610086591
primary pancreatic ductal adenocarcinoma 1271 0.00549518899469215
pancreatic cancer 2300 0.00640120266196759
Disease Target Count Z-score Confidence
Neurodegenerative disease 383 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2346 3.047 1.5

Expression

Synonym

Accession P07737 Q53Y44
Symbols ALS18

Gene

PDB

2PAV   2PBD   3CHW   1AWI   1CF0   1CJF   1FIK   1FIL   1PFL   4X1L   4X1M   4X25  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

Gene RIF (69)

PMID Text
26787927 evidence, which suggests that Profilin increases tumour suppressor activity by regulating NF-kappaB.
26572741 Actin independent mechanisms contribute to the pathogenicity of PFN1 T109M and possibly other PFN1 mutations.
26499959 expression of the ALS-associated actin-binding deficient mutant of PFN1 (PFN1(C71G)) results in increased dendritic arborisation and spine formation, and cytoplasmic inclusions in cultured mouse hippocampal neurons
26227615 Profilin-1 folding process occurs in the absence of thermodynamically stable partially folded states.
26226631 Mutations of profilin-1, associated with familial amyotrophic lateral sclerosis, increase the tendency of profilin-1 to aggregate and that such aggregation behavior is largely determined by the mutation-induced structural changes occurring in the folded state of the protein.
26056300 findings suggest that a destabilized form of PFN1 underlies PFN1-mediated ALS pathogenesis
25741138 Suggest that PFN1 plays a critical role in gastric carcinoma progression, and these effects are likely mediated through the integrin beta1/FAK pathway.
25704627 Higher messenger RNA expression of Profilin-1 is associated with significantly lower survival
25613364 Profilin1 acts as a molecular regulator of the levels of PI(3,4)P2 and Tks5 recruitment in invadopodia to control the invasion efficiency of invadopodia.
25499087 PFN1 is a rare cause of ALS.
More...

AA Sequence

MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQK      1 - 70
CSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY     71 - 140
//

Text Mined References (125)

PMID Year Title
26787927 2016 Profilin-PTEN interaction suppresses NF-?B activation via inhibition of IKK phosphorylation.
26572741 2015 Profilin 1 with the amyotrophic lateral sclerosis associated mutation T109M displays unaltered actin binding and does not affect the actin cytoskeleton.
26499959 2015 Amyotrophic lateral sclerosis-associated mutant profilin 1 increases dendritic arborisation and spine formation in primary hippocampal neurons.
26227615 2015 The Folding process of Human Profilin-1, a novel protein associated with familial amyotrophic lateral sclerosis.
26226631 2015 Mutations of Profilin-1 Associated with Amyotrophic Lateral Sclerosis Promote Aggregation Due to Structural Changes of Its Native State.
26056300 2015 Structural basis for mutation-induced destabilization of profilin 1 in ALS.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25741138 2015 Silencing profilin-1 inhibits gastric cancer progression via integrin ?1/focal adhesion kinase pathway modulation.
25704627 2015 Profilin-1 expression is associated with high grade and stage and decreased disease-free survival in renal cell carcinoma.
25613364 2015 Profilin1 regulates invadopodium maturation in human breast cancer cells.
More...