Property Summary

NCBI Gene PubMed Count 133
PubMed Score 223.47
PubTator Score 159.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2499 3.078 1.5
Disease Target Count
Amyotrophic lateral sclerosis 451

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.268 1.4e-07
astrocytoma 1.400 1.3e-03
Astrocytoma, Pilocytic 1.300 4.5e-06
atypical teratoid / rhabdoid tumor 2.100 1.2e-09
Becker muscular dystrophy 1.022 5.0e-05
glioblastoma 1.300 2.1e-07
intraductal papillary-mucinous carcinoma... 1.100 1.7e-03
lung adenocarcinoma 1.373 1.3e-06
medulloblastoma 1.100 4.8e-04
medulloblastoma, large-cell 1.500 2.4e-04
Multiple myeloma 1.943 2.6e-03
ovarian cancer 2.900 1.0e-06
pancreatic cancer 1.200 6.4e-03
pediatric high grade glioma 1.700 2.8e-07
primary pancreatic ductal adenocarcinoma 1.148 5.5e-03
primitive neuroectodermal tumor 1.300 2.6e-04
psoriasis -1.500 3.3e-04
Rheumatoid arthritis -1.400 1.9e-03
Waldenstrons macroglobulinemia 1.314 5.4e-03

Gene RIF (82)

AA Sequence

MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQK      1 - 70
CSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY     71 - 140
//

Text Mined References (143)

PMID Year Title