Property Summary

NCBI Gene PubMed Count 188
Grant Count 249
R01 Count 119
Funding $50,472,039.77
PubMed Score 2306.87
PubTator Score 678.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 0.002
psoriasis 2.000 0.000
glioblastoma 1.700 0.001
medulloblastoma, large-cell -1.200 0.000
tuberculosis -3.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.606 0.004
Multiple Sclerosis 1.300 0.035
inflammatory breast cancer 1.300 0.004
lung carcinoma -1.300 0.000
gastric carcinoma 1.200 0.042
ovarian cancer -2.000 0.000
dermatomyositis 1.100 0.027

Synonym

Accession P07711 Q6IAV1 Q96QJ0
Symbols MEP
CATL
CTSL1

Gene

PANTHER Protein Class (3)

PDB

3KSE   1CJL   1CS8   1ICF   1MHW   2NQD   2VHS   2XU1   2XU3   2XU4   2XU5   2YJ2   2YJ8   2YJ9   2YJB   2YJC   3BC3   3H89   3H8B   3H8C   3HHA   3HWN   3IV2   3K24   3OF8   3OF9   4AXL   4AXM   5F02   5I4H  

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
460 screening 100 / 0 / 57721 Cathepsin L
825 confirmatory 48 / 4 / 50 Cathepsin L dose-response confirmation
1627 confirmatory 49 / 7 / 185 Cathepsin L dose-response testing in the presence of cysteine
1633 confirmatory 1 / 0 / 0 Cathepsin L probe dose-response testing
1636 confirmatory 1 / 0 / 0 Cathepsin L probe #2 dose-response testing

Gene RIF (127)

PMID Text
26960148 p41 fragment is also shown to reduce the secretion of interleukin-12 (IL-12/p70) during the subsequent maturation of treated dendritic cells.
26953343 Mechanistic studies showed that teicoplanin blocks Ebola virus entry by specifically inhibiting the activity of cathepsin L, opening a novel avenue for the development of additional glycopeptides as potential inhibitors of cathepsin L-dependent viruses.
26797274 Our findings highlight the potential role of CTSL in the cross talk between autophagy and apoptosis, which might be considered a therapeutic strategy for treatment of pathologic conditions associated with neurodegeneration.
26757413 these data indicate that the CTSL inhibitor KGP94 has the potential to alleviate metastatic disease progression and associated skeletal morbidities and hence may have utility in the treatment of advanced prostate cancer patients
26757339 cathepsin L activity was decreased in p53 positive cells after adriamycin treatment, but not in p53 negative cells.
26706414 Knockdown of Cathepsin L promotes radiosensitivity of glioma stem cells both in vivo and in vitro.
26343556 Data suggest that nuclear cathepsin L accelerates cell cycle progression of HCT116 colorectal carcinoma cells.
26299995 Cathepsin L targeting in cancer treatment
26081835 shedding of surface proteins by extracellular cathepsins impacts intracellular signaling as demonstrated for regulation of Ras GTPase activity.
25991043 In addition, cathepsin L positively correlates with MMP2. PRACTICE: The cathepsin L may be used as a monitoring index in age-related diseases.
More...

AA Sequence

MNPTLILAAFCLGIASATLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREGK      1 - 70
HSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWA     71 - 140
FSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEES    141 - 210
CKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLV    211 - 280
VGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV                     281 - 333
//

Text Mined References (194)

PMID Year Title
26960148 2016 Exogenous Thyropin from p41 Invariant Chain Diminishes Cysteine Protease Activity and Affects IL-12 Secretion during Maturation of Human Dendritic Cells.
26953343 2016 Glycopeptide Antibiotics Potently Inhibit Cathepsin L in the Late Endosome/Lysosome and Block the Entry of Ebola Virus, Middle East Respiratory Syndrome Coronavirus (MERS-CoV), and Severe Acute Respiratory Syndrome Coronavirus (SARS-CoV).
26797274 2016 Activated cathepsin L is associated with the switch from autophagy to apoptotic death of SH-SY5Y cells exposed to 6-hydroxydopamine.
26757413 2016 Cathepsin L inactivation leads to multimodal inhibition of prostate cancer cell dissemination in a preclinical bone metastasis model.
26757339 2016 Cystatin C as a p53-inducible apoptotic mediator that regulates cathepsin L activity.
26706414 2016 Knockdown of Cathepsin L promotes radiosensitivity of glioma stem cells both in vivo and in vitro.
26343556 2016 Nuclear cathepsin L activity is required for cell cycle progression of colorectal carcinoma cells.
26299995 2015 Cathepsin L targeting in cancer treatment.
26081835 2015 Proteomic Identification of Cysteine Cathepsin Substrates Shed from the Surface of Cancer Cells.
25991043 Differential levels of cathepsin B and L in serum between young and aged healthy people and their association with matrix metalloproteinase 2.
More...