Property Summary

NCBI Gene PubMed Count 108
Grant Count 93
R01 Count 74
Funding $20,265,601.91
PubMed Score 217.69
PubTator Score 197.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.766 0.000
psoriasis -2.100 0.000
chronic lymphosyte leukemia -1.100 0.000
astrocytoma 1.900 0.020
acute quadriplegic myopathy 1.223 0.000
ovarian cancer -2.700 0.000

Gene

PDB

1M12   1N69   1SN6   2DOB   2GTG   2QYP   2R0R   2R1Q   2RB3   2Z9A   3BQP   3BQQ   4DDJ   4UEX   4V2O  

 GWAS Trait (1)

Gene RIF (45)

PMID Text
26370502 Prosaposin facilitates sortilin-independent lysosomal trafficking of progranulin.
26341737 PSAP is a secreted biomarker.
26045750 Data suggested that the abundance of Psap in sperm sample may be a sensitive endpoint to predict PCB exposure.
25926625 Our findings suggest a novel pharmacological approach to Sap C deficiency directed to treat major secondary pathological aspects in this disorder.
24966325 findings support a lung metastasis-promoting function of the miR-23b/27b/24 cluster of miRNAs, which functions in part through the direct inhibition of PSAP in breast cancer
24872419 Mesotrypsin generated saposins A-D from prosaposin, and mature caspase-14 contributed to this process by activating mesotrypsinogen to mesotrypsin. Knockdown of these proteases markedly down-regulated saposin A synthesis in skin equivalent models.
24657443 Of the 2575 proteins identified, proteins upregulated in gallbladder cancer included several lysosomal proteins such as prosaposin, cathepsin Z and cathepsin H.
24070323 Saposin C protects glucocerebrosidase against alpha-synuclein inhibition.
23417432 Urine of patients with early prostate cancer contains lower levels of light chain fragments of inter-alpha-trypsin inhibitor and prosaposin fragment or saposin B.
22738294 These findings suggested that prosaposin might enhance estrogen receptor alpha-mediated signaling axis and play a role in breast cancer development and progression.
More...

AA Sequence

MYALFLLASLLGAALAGPVLGLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWNKPTVKSLPCDICKDVV      1 - 70
TAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCES     71 - 140
LQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQT    141 - 210
AVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQ    211 - 280
TLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLP    281 - 350
KSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLD    351 - 420
RNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLL    421 - 490
GTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN                                        491 - 524
//

Text Mined References (119)

PMID Year Title
26370502 2015 Prosaposin facilitates sortilin-independent lysosomal trafficking of progranulin.
26341737 2015 Prosaposin activates the androgen receptor and potentiates resistance to endocrine treatment in breast cancer.
26045750 2015 Decrease in prosaposin in spermatozoon is associated with polychlorinated biphenyl exposure.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25926625 2015 BCM-95 and (2-hydroxypropyl)-?-cyclodextrin reverse autophagy dysfunction and deplete stored lipids in Sap C-deficient fibroblasts.
25519158 2015 Prosaposin: a protein with differential sorting and multiple functions.
24966325 2014 The microRNA-23b/27b/24 cluster promotes breast cancer lung metastasis by targeting metastasis-suppressive gene prosaposin.
24872419 2014 Mesotrypsin and caspase-14 participate in prosaposin processing: potential relevance to epidermal permeability barrier formation.
24657443 2014 Identification of prosaposin and transgelin as potential biomarkers for gallbladder cancer using quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...