Property Summary

NCBI Gene PubMed Count 208
PubMed Score 1155.44
PubTator Score 431.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Heart disease 306 0.0 1.0
Disease Target Count Z-score Confidence
Congenital stromal corneal dystrophy 5 0.0 5.0

Expression

  Differential Expression (39)

Disease log2 FC p
adrenocortical adenoma -1.068 4.9e-02
adrenocortical carcinoma -2.900 4.9e-03
aldosterone-producing adenoma -1.193 3.4e-02
Astrocytoma, Pilocytic 1.100 7.6e-03
Atopic dermatitis -2.000 7.2e-05
autosomal dominant Emery-Dreifuss muscul... 1.261 2.8e-02
breast carcinoma -1.200 3.4e-16
colon cancer -2.400 5.4e-03
cutaneous lupus erythematosus -1.100 3.4e-02
cystic fibrosis -2.631 7.7e-07
Down syndrome 1.300 2.9e-03
Duchenne muscular dystrophy 1.549 2.4e-06
ductal carcinoma in situ -1.200 9.6e-03
ependymoma -2.100 4.4e-02
facioscapulohumeral dystrophy -1.300 4.1e-02
glioblastoma 2.100 3.4e-02
interstitial lung disease 1.300 1.1e-02
intraductal papillary-mucinous adenoma (... -2.800 2.3e-04
intraductal papillary-mucinous carcinoma... -4.000 1.6e-04
intraductal papillary-mucinous neoplasm ... -4.300 1.5e-03
invasive ductal carcinoma -1.700 4.9e-04
limb girdle muscular dystrophy 2A 1.128 1.8e-03
lung adenocarcinoma -1.300 5.3e-07
lung cancer -2.700 8.2e-06
lung carcinoma -3.000 1.4e-20
malignant mesothelioma -5.400 1.2e-09
medulloblastoma 1.100 1.4e-02
medulloblastoma, large-cell 1.200 1.3e-03
non primary Sjogren syndrome sicca 1.200 3.7e-02
non-small cell lung cancer -1.609 2.5e-12
osteosarcoma 2.718 9.3e-04
ovarian cancer -4.300 1.7e-10
pancreatic cancer 1.800 2.3e-04
Pick disease 1.100 8.6e-03
pituitary cancer -2.200 6.8e-05
Polycystic ovary syndrome 1.096 1.5e-02
primary pancreatic ductal adenocarcinoma 1.796 2.0e-04
psoriasis -1.200 9.0e-05
ulcerative colitis 2.500 1.5e-04

Protein-protein Interaction (5)

Gene RIF (155)

AA Sequence

MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDL      1 - 70
GLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQ     71 - 140
LKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADT    141 - 210
NITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNK    211 - 280
LTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVR    281 - 350
SAIQLGNYK                                                                 351 - 359
//

Text Mined References (209)

PMID Year Title