Property Summary

NCBI Gene PubMed Count 195
Grant Count 366
R01 Count 214
Funding $49,463,471.79
PubMed Score 1058.33
PubTator Score 431.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (55)

Disease Z-score Confidence
Lyme disease 23 5.319 2.7
Ehlers-Danlos syndrome 42 4.8 2.4
Cancer 2,346 3.839 1.9
Osteoarthritis 96 3.756 1.9
Corneal disease 32 3.752 1.9
Degenerative disc disease 28 3.255 1.6
Kidney disease 396 3.181 1.6
Atherosclerosis 275 3.139 1.6
Renal artery atheroma 2 3.112 1.6
Myopia 99 3.071 1.5
Atopic dermatitis 944
Corneal Dystrophy, Congenital Stromal 1
Down syndrome 548
Duchenne muscular dystrophy 602
Endometrial Neoplasms 50
Fibrosis 40
Muscular Dystrophy, Facioscapulohumeral 12
Myocardial Ischemia 169
Nephritis, Interstitial 10
Pick disease 1,893
Polycystic Ovary Syndrome 332
adrenocortical adenoma 134
adrenocortical carcinoma 1,427
aldosterone-producing adenoma 664
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
colon cancer 1,475
cutaneous lupus erythematosus 1,056
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
ependymoma 2,514
facioscapulohumeral dystrophy 286
glioblastoma 5,572
interstitial lung disease 291
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
limb girdle muscular dystrophy 2A 156
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
non primary Sjogren syndrome sicca 840
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pilocytic astrocytoma 3,086
pituitary cancer 1,972
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
sonic hedgehog group medulloblastoma 1,482
ulcerative colitis 2,087

Expression

Synonym

Accession P07585 Q9P0Z0 Q9P0Z1 Q9Y5N8 Q9Y5N9
Symbols CSCD
PG40
PGII
PGS2
DSPG2
SLRR1B

Gene

DCN

Gene RIF (145)

PMID Text
26828927 Decorin plays a key role in the maintenance of the order in the normal corneal extracellular matrix.
26697491 An emerging concept that multiple proteases, especially those produced by inflammatory cells, are capable of cleaving DCN suggests that native DCN could be inactivated in a number of pathological inflammatory conditions
26554635 increased blood DCN levels could be a candidate biomarker for PE.
26400336 Compared with bone graft and marrow cavity contents, sticking scars had the highest expression of BMP-2 while bone grafts had the highest expression of DCN.
26001829 decorin expression and immunoreactivity in normal and malignant human colorectal tissue
25661523 Data show that decorin is not only associated with angiogenesis, but it plays a causal role in this process. Also, depending on the molecular microenvironment where angiogenesis is induced, decorin can either promote or inhibit angiogenesis. [review]
25656619 Defective Proteolytic Processing of Fibrillar Procollagens and Prodecorin Due to Biallelic BMP1 Mutations Results in a Severe, Progressive Form of Osteogenesis Imperfecta.
25550184 DCN is a key regulator for chemoresistant mechanisms.
25524578 decorin plays crucial roles in non-small-cell lung cancer against carcinogenesis and progression.
25407518 findings indicate that decorin may indirectly act as an antagonist to MM cell survival and that the interplay between MM and decorin may be an important target to explore in manipulating the tumor niche to inhibit tumorigenesis
More...

AA Sequence

MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDL      1 - 70
GLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQ     71 - 140
LKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADT    141 - 210
NITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNK    211 - 280
LTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVR    281 - 350
SAIQLGNYK                                                                 351 - 359
//

Text Mined References (196)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26828927 2016 Role of Decorin Core Protein in Collagen Organisation in Congenital Stromal Corneal Dystrophy (CSCD).
26697491 2015 Decorin: A Growth Factor Antagonist for Tumor Growth Inhibition.
26554635 2016 Restraint of Trophoblast Invasion of the Uterus by Decorin: Role in Pre-eclampsia.
26400336 2015 Bone morphogenetic protein 2 and decorin expression in old fracture fragments and surrounding tissues.
26001829 2015 Decorin in Human Colon Cancer: Localization In Vivo and Effect on Cancer Cell Behavior In Vitro.
25661523 2015 Pivotal role for decorin in angiogenesis.
25656619 2015 Defective Proteolytic Processing of Fibrillar Procollagens and Prodecorin Due to Biallelic BMP1 Mutations Results in a Severe, Progressive Form of Osteogenesis Imperfecta.
25550184 2015 Decorin in human oral cancer: a promising predictive biomarker of S-1 neoadjuvant chemosensitivity.
25524578 2015 Decorin is responsible for progression of non-small-cell lung cancer by promoting cell proliferation and metastasis.
More...