Property Summary

Ligand Count 409
NCBI Gene PubMed Count 949
PubMed Score 1680.90
PubTator Score 2620.80

Knowledge Summary

Patent (31,196)

TINX Plot

  Disease (7)

Disease Target Count
Asthma 385
Acute exacerbation of asthma 14
Adjunct Therapy to Achieve Long-term Asthma Control 1
Administration of Local Anesthetic Nerve Block 14
Allergic Reactions 7
Allergic asthma 6
Allergic conjunctivitis 22
Allergic rhinitis 94
Angina Pectoris 32
Anxiety 136
Arrhythmias During Surgery 2
Asthma management 19
Atrial Fibrillation 124
Atrioventricular block 35
Bronchiectasis 64
Bronchitis 43
Bronchospasm 9
Bronchospasm Prevention 1
Bronchospasm Prevention with COPD 3
COPD Associated with Chronic Bronchitis 11
Cardiac Decompensation 2
Cardiac Decompensation Post Cardiac Surgery 2
Cardiac arrest 36
Cardiogenic shock 2
Chronic Obstructive Pulmonary Disease with Bronchospasms 8
Chronic bronchitis 4
Chronic heart failure 46
Chronic obstructive lung disease 6
Common cold 67
Decompensated cardiac failure 9
Disorder of lung 7
Dyspnea 76
Essential tremor 28
Exacerbation of asthma 11
Exercise-Induced Bronchospasm Prevention 2
Glaucoma 239
Headache disorder 19
Hemangioma 69
Hypertensive disorder 56
Hypertrophic Cardiomyopathy 117
Hypovolemic shock 2
Idiopathic hypertrophic subaortic stenosis 2
Influenza-like symptoms 16
Itching of skin 18
Left ventricular cardiac dysfunction 9
Life-Threatening Ventricular Tachycardia 15
Local anesthesia, by infiltration 14
Low blood pressure 9
Low cardiac output syndrome 2
Migraine Prevention 23
Minor Skin Wound Pain 12
Myocardial Reinfarction Prevention 6
Nasal congestion 21
Nasal discharge 24
Non-allergic asthma 5
Ocular hypertension 42
Open-angle glaucoma 27
Organic Cardiac Disease 2
Orthostatic hypotension 9
Parkinson's disease 392
Pheochromocytoma Adjunct Therapy 2
Premature labor 1
Prevention of Bronchospasm with Chronic Bronchitis 1
Prevention of Bronchospasms with Emphysema 1
Pulmonary emphysema 48
Rhinitis 54
Seasonal allergic rhinitis 9
Sinus headache 16
Skin irritation 12
Sneezing 12
Supraventricular tachycardia 3
Syncope due to Heart Block 2
Tear film insufficiency 15
Thick Bronchial Secretions 2
Vasomotor rhinitis 12
Ventricular arrhythmia 27
Wheezing 7
anaphylaxis 11
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count
Asthma, susceptibility to 11

Expression

  Differential Expression (15)

Disease log2 FC p
Breast cancer -1.600 8.0e-08
breast carcinoma -1.800 8.2e-05
Chronic Lymphocytic Leukemia 1.318 1.0e-04
colon cancer -1.900 1.3e-03
ductal carcinoma in situ -1.500 1.9e-03
ependymoma 1.500 8.1e-06
fibroadenoma -1.800 7.6e-03
group 3 medulloblastoma -1.400 2.8e-04
invasive ductal carcinoma -1.700 6.0e-03
lung adenocarcinoma -3.100 1.6e-17
lung cancer -5.000 7.9e-07
non-small cell lung cancer -2.675 3.7e-24
osteosarcoma -3.161 3.4e-05
ovarian cancer -1.200 2.0e-05
psoriasis -1.200 3.9e-06

 CSPA Cell Line (2)

PDB (22)

Gene RIF (1047)

AA Sequence

MGQPGNGSAFLLAPNGSHAPDHDVTQERDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNY      1 - 70
FITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFK     71 - 140
YQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYANETCCDFFTNQAYAIASSIVSFYV    141 - 210
PLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMG    211 - 280
TFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAY    281 - 350
GNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL           351 - 413
//

Text Mined References (959)

PMID Year Title