Property Summary

NCBI Gene PubMed Count 908
Grant Count 627
R01 Count 347
Funding $88,123,167.09
PubMed Score 1614.13
PubTator Score 2620.80

Knowledge Summary

Patent (31,196)

TINX Plot

  Disease Relevance (113)

Disease Z-score Confidence
Asthma 349 5.978 3.0
Hypertension 287 4.279 2.1
Obesity 616 4.266 2.1
Chronic obstructive pulmonary disease 146 4.259 2.1
Heart disease 279 3.849 1.9
Coronary artery disease 240 3.572 1.8
Acute exacerbation of asthma 14
Adjunct Therapy to Achieve Long-term Ast... 1 
Administration of Local Anesthetic Nerve... 14 
Allergic Reactions 7
Allergic asthma 6
Allergic conjunctivitis 25
Allergic rhinitis 91
Angina pectoris 21
Anxiety 24
Arrhythmias During Surgery 2
Asthma management 20
Atrial Fibrillation 110
Atrioventricular block 21
Autistic Disorder 320
Breast cancer 3,094
Bronchiectasis 29
Bronchitis 44
Bronchospasm 9
Bronchospasm Prevention 1
Bronchospasm Prevention with COPD 3
COPD Associated with Chronic Bronchitis 11
Cardiac Decompensation 2
Cardiac Decompensation Post Cardiac Surg... 2 
Cardiac arrest 26
Cardiogenic shock 2
Cardiomyopathies 90
Cardiomyopathy, Dilated 47
Chronic Lymphocytic Leukemia 242
Chronic Obstructive Pulmonary Disease wi... 8 
Chronic bronchitis 4
Chronic heart failure 46
Chronic obstructive lung disease 6
Common cold 63
Decompensated cardiac failure 9
Disorder of lung 7
Dyspnea 8
Essential tremor 30
Exacerbation of asthma 11
Exercise-Induced Bronchospasm Prevention 2
Fibrosis 40
Glaucoma 134
Headache disorder 20
Hemangioma 35
Hyperlipidemia 25
Hypertensive disorder 58
Hypertrophic Cardiomyopathy 56
Hypokalemia 40
Hypovolemic shock 2
Idiopathic hypertrophic subaortic stenos... 2 
Influenza-like symptoms 17
Insulin Resistance 48
Itching of skin 19
Left ventricular cardiac dysfunction 9
Life-Threatening Ventricular Tachycardia 15
Local anesthesia, by infiltration 14
Low blood pressure 9
Low cardiac output syndrome 2
Lung diseases 48
Migraine Prevention 22
Minor Skin Wound Pain 12
Myocardial Ischemia 169
Myocardial Reinfarction Prevention 6
Nasal congestion 24
Nasal discharge 26
Non-allergic asthma 5
Ocular hypertension 27
Open-angle glaucoma 26
Organic Cardiac Disease 2
Orthostatic hypotension 9
Parkinson's disease 364
Peripheral Neuropathy 303
Pheochromocytoma Adjunct Therapy 2
Premature labor 1
Prevention of Bronchospasm with Chronic ... 1 
Prevention of Bronchospasms with Emphyse... 1 
Prostatic Neoplasms 471
Pulmonary emphysema 34
Rhinitis 46
Seasonal allergic rhinitis 10
Sinus headache 17
Skin irritation 12
Sneezing 11
Stomach Neoplasms 282
Supraventricular tachycardia 2
Syncope due to Heart Block 2
Tear film insufficiency 14
Thick Bronchial Secretions 2
Tremor 8
Vasomotor rhinitis 15
Ventricular Dysfunction, Left 15
Ventricular arrhythmia 14
Wheezing 7
anaphylaxis 11
breast carcinoma 1,614
colon cancer 1,475
ductal carcinoma in situ 1,745
fibroadenoma 557
group 3 medulloblastoma 2,254
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
nervous system disorder 53
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
posterior fossa group A ependymoma 1,511
psoriasis 6,685

Expression

  Differential Expression (15)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.318 0.000
psoriasis -2.600 0.000
osteosarcoma -3.161 0.000
posterior fossa group A ependymoma 2.100 0.000
non-small cell lung cancer -2.675 0.000
lung cancer -6.300 0.000
colon cancer -1.900 0.001
breast carcinoma -1.800 0.000
fibroadenoma -1.800 0.008
group 3 medulloblastoma -1.400 0.000
lung adenocarcinoma -3.100 0.000
Breast cancer -1.600 0.000
ductal carcinoma in situ -1.500 0.002
invasive ductal carcinoma -1.700 0.006
ovarian cancer -1.200 0.000

Gene

PANTHER Protein Class (2)

PDB

1GQ4   2R4R   2R4S   2RH1   3D4S   3KJ6   3NY8   3NY9   3NYA   3P0G   3PDS   3SN6   4GBR   4LDE   4LDL   4LDO   4QKX   5D5A   5D5B   5D6L   5JQH  

  TechDev Info (1)

MLP Assay (41)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
485366 confirmatory 0 / 15 / 1265 qHTS validation assay of beta-arrestin-biased ligands of beta2-adrenergic receptor
485386 summary 0 / 0 / 0 qHTS assay of beta-arrestin-biased ligands of beta2-adrenergic receptor: Summary
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
492947 confirmatory 80 / 1312 / 329716 qHTS assay of beta-arrestin-biased ligands of beta2-adrenergic receptor
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
More...

Gene RIF (1011)

PMID Text
27362234 functional evidence that G-protein coupling to the beta2AR stabilizes a 'closed' receptor conformation characterized by restricted access to and egress from the hormone-binding site
26994621 None of the four polymorphisms in ADRB2 gene were associated with a risk of asthma in a current children population
26803058 beta2-adrenergic receptor signaling promotes pancreatic ductal adenocarcinoma progression by facilitating PCBP2-dependent c-myc expression.
26771271 Suggest that the ADRB2 Gly16Arg polymorphism is predictive of perioperative vasopressor requirements in patients anesthetized for elective neurosurgery.
26587832 Our results suggest that rare nonsynonymous variants contribute to the development of asthma following severe RSV bronchiolitis in infancy, notably in ADRB2
26578769 Single-molecule view of basal activity and activation mechanisms of the G protein-coupled receptor beta2AR.
26571351 Allosteric regulation of beta-2 adrenoreceptor by phospholipids
26526356 Our data suggest that b2-AR may be a new useful biomarker for predicting prognosis in Her2-positive breast cancer and may also be a promising selective therapeutic target for the aggressive subtype of breast cancer.
26475619 High constitutive Akt2 activity in U937 promonocytes: effective reduction of Akt2 phosphorylation by the histamine H2-receptor and the beta2-adrenergic receptor
26369942 ADRB2 genotype may be predictive of severity of acute respiratory tract infections in African Americans.
More...

AA Sequence

MGQPGNGSAFLLAPNGSHAPDHDVTQERDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNY      1 - 70
FITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFK     71 - 140
YQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYANETCCDFFTNQAYAIASSIVSFYV    141 - 210
PLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMG    211 - 280
TFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAY    281 - 350
GNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL           351 - 413
//

Text Mined References (918)

PMID Year Title
27362234 2016 Allosteric coupling from G protein to the agonist-binding pocket in GPCRs.
26994621 2016 An association and meta-analysis study of 4 SNPs from beta-2 adrenergic receptor (ADRB2) gene with risk of asthma in children.
26803058 2016 ?2-adrenergic receptor signaling promotes pancreatic ductal adenocarcinoma (PDAC) progression through facilitating PCBP2-dependent c-myc expression.
26771271 2016 The Gly16 Allele of the Gly16Arg Single-Nucleotide Polymorphism in the ??-Adrenergic Receptor Gene Augments Perioperative Use of Vasopressors: A Retrospective Cohort Study.
26587832 2015 Pooled Sequencing of Candidate Genes Implicates Rare Variants in the Development of Asthma Following Severe RSV Bronchiolitis in Infancy.
26578769 2015 Single-molecule view of basal activity and activation mechanisms of the G protein-coupled receptor ?2AR.
26571351 2016 Allosteric regulation of G protein-coupled receptor activity by phospholipids.
26526356 2015 A Her2-let-7-?2-AR circuit affects prognosis in patients with Her2-positive breast cancer.
26475619 2016 High constitutive Akt2 activity in U937 promonocytes: effective reduction of Akt2 phosphorylation by the histamine H2-receptor and the ?2-adrenergic receptor.
26369942 2015 ?2-Adrenergic receptor promoter haplotype influences the severity of acute viral respiratory tract infection during infancy: a prospective cohort study.
More...