Property Summary

NCBI Gene PubMed Count 20
PubMed Score 1175.17
PubTator Score 65.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Synonym

Accession P07498 Q13575
Symbols KCA
CSNK
CNS10
CSN10

Gene

  Ortholog (8)

Gene RIF (4)

PMID Text
22536414 CSN3 was found to contain an interesting coding polymorphism as well as containing excess rare variation as compared with the other genes evaluated in cerebral ischemia patients.
18505157 human milk plasma protein exterts an apoptotic effect on MCF-7 adenocarcinoma cells.
17846126 Observational study of gene-disease association. (HuGE Navigator)
15866733 The recombinant Caseinomacropeptide (hCMP)has been produced as a secretory product in yeast and was estimated to be 7.0kDa by SDS-PAGE, and showed a lower glycosylation than the natural bovine CMP.

AA Sequence

MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIA      1 - 70
INNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATV     71 - 140
EPTPAPATEPTVDSVVTPEAFSESIITSTPETTTVAVTPPTA                                141 - 182
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22536414 2012 Rare variants in ischemic stroke: an exome pilot study.
18505157 Lactaptin is a human milk protein inducing apoptosis of MCF-7 adenocarcinoma cells.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
17846126 2007 Identification of novel candidate genes for type 2 diabetes from a genome-wide association scan in the Old Order Amish: evidence for replication from diabetes-related quantitative traits and from independent populations.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15866733 2005 Purification and characterization of human caseinomacropeptide produced by a recombinant Saccharomyces cerevisiae.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...