Property Summary

NCBI Gene PubMed Count 20
PubMed Score 1215.80
PubTator Score 65.68

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIA      1 - 70
INNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATV     71 - 140
EPTPAPATEPTVDSVVTPEAFSESIITSTPETTTVAVTPPTA                                141 - 182
//

Text Mined References (20)

PMID Year Title