Property Summary

NCBI Gene PubMed Count 64
Grant Count 455
R01 Count 256
Funding $45,610,652.58
PubMed Score 2732.88
PubTator Score 1520.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P07492 P07491 P81553 Q14454 Q53YA0 Q9BSY7 GRP
Symbols BN
GRP-10
proGRP
preproGRP

Gene

GRP

PDB

2N0B   2N0C   2N0D   2N0E   2N0F   2N0G   2N0H  

Gene RIF (44)

PMID Text
26730601 Data show that serum neuron-specific enolase, cytokeratin 19 fragment 21-1, pro-gastrin-releasing peptide, squamous cell carcinoma antigen, tissue inhibitor of metalloproteinase-1, and human epididymis protein 4 are not associated with brain metastases.
24912045 No association of 16 GRP and 7 GRPR variants were found with agoraphobia with/without panic disorder.
24901518 Our results suggest that progastrin inhibits the acquisition of a M2-phenotype in human macrophages.
24375395 High serum proGRP levels are associated with small-cell lung cancer.
24108003 the role of autophagy in the degradation of gastrin-releasing peptide and subsequent inhibition of angiogenesis
24039782 GRP silencing decreases anchorage-independent growth, inhibits cell migration and neuroblastoma cell-mediated angiogenesis.
23924923 The levels of GRP were upregulated in cells treated with HGF in a dose-dependent manner. HGF-induced expression of Ets-1 and IL-8 was increased more by GRP treatment.
23615431 GRP-expressing C and A delta fibers that coexpress SP or CGRP makes these neurons pruriceptors.
23608754 inhibits the process of autophagy in vascular endothelial cells, thereby increasing endothelial cell proliferation and tubule formation
23379566 The Gastrin-releasing peptide(GRP)triggers the growth of HepG2 cells through blocking the ER stress-mediated pathway.
More...

AA Sequence

MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQ      1 - 70
LREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREG     71 - 140
RNPQLNQQ                                                                  141 - 148
//

Text Mined References (65)

PMID Year Title
26730601 2016 Serum Biomarkers Associated with Clinical Outcomes Fail to Predict Brain Metastases in Patients with Stage IV Non-Small Cell Lung Cancers.
24912045 2014 Analysis of gastrin-releasing peptide gene and gastrin-releasing peptide receptor gene in patients with agoraphobia.
24901518 2014 Progastrin represses the alternative activation of human macrophages and modulates their influence on colon cancer epithelial cells.
24375395 2014 The prognostic significance of the circulating neuroendocrine markers chromogranin A, pro-gastrin-releasing peptide, and neuron-specific enolase in patients with small-cell lung cancer.
24108003 2013 Enhanced autophagy blocks angiogenesis via degradation of gastrin-releasing peptide in neuroblastoma cells.
24039782 2013 Targeting gastrin-releasing peptide suppresses neuroblastoma progression via upregulation of PTEN signaling.
23924923 2013 Hepatocyte growth factor-mediated gastrin-releasing peptide induces IL-8 expression through Ets-1 in gastric cancer cells.
23615431 2013 Gastrin-releasing peptide-expressing nerves comprise subsets of human cutaneous A? and C fibers that may sense pruritus.
23608754 2013 Autophagy mediates paracrine regulation of vascular endothelial cells.
23379566 2013 Human gastrin-releasing peptide triggers growth of HepG2 cells through blocking endoplasmic reticulum stress-mediated apoptosis.
More...