Property Summary

NCBI Gene PubMed Count 71
PubMed Score 2788.92
PubTator Score 1520.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ductal carcinoma in situ 1.500 2.0e-02
ependymoma -1.400 2.2e-03
fibroadenoma 2.400 2.3e-02
head and neck cancer and chronic obstruc... -2.000 5.7e-03
intraductal papillary-mucinous adenoma (... -2.200 3.7e-04
intraductal papillary-mucinous carcinoma... -2.200 6.4e-04
invasive ductal carcinoma 2.459 4.3e-05
lung cancer 5.200 3.0e-07
lung carcinoma 5.900 2.1e-45
non-small cell lung cancer and chronic o... -1.800 1.4e-02
oligodendroglioma -1.200 2.5e-03
osteosarcoma 1.362 4.6e-02
psoriasis -1.300 9.3e-08
sonic hedgehog group medulloblastoma -1.400 2.6e-03

Protein-protein Interaction (12)

Gene RIF (51)

AA Sequence

MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQ      1 - 70
LREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREG     71 - 140
RNPQLNQQ                                                                  141 - 148
//

Text Mined References (72)

PMID Year Title