Property Summary

NCBI Gene PubMed Count 54
PubMed Score 0.00
PubTator Score 30.09

Knowledge Summary

Patent

No data available

Synonym

Accession P07478
Symbols TRY2
TRY8
TRYP2

Gene

PANTHER Protein Class (3)

Gene RIF (37)

PMID Text
26110235 evaluated the association of claudin2 and PRSS1-PRSS2 polymorphisms with idiopathic recurrent acute (RAP) and chronic pancreatitis
25916077 Serum trypsinogen-2 is associated with pancreatic cancer and pancreatitis.
25253127 PRSS2 single nucleotide polymorphism associated with the development of alcoholic pancreatitis.
23882137 Trypsin-1 and trypsin-2 appear to have a function in the degradation of vitreous type II collagen.
23143602 Two associations with alcoholic pancreatitis at genome-wide significance were identified and replicated at PRSS1-PRSS2 and X-linked CLDN2 through a two-stage genome-wide study.
22909050 trypsin-2 over-expression enhanced tongue carcinoma cell invasion by various genetic and proteolytic mechanisms.
22481290 Report a simple, rapid, easy, and noninvasive urinary trypsinogen-2 test can diagnose or rule out most cases of acute pancreatitis.
22357509 Elevation of urine trypsinogen 2 is an independent risk factor for pancreatic fistula after pancreaticoduodenectomy.
21946810 Data show that urinary trypsinogen-2 dipstick test is a useful test for early diagnosis of post-endoscopic retrograde cholangiopancreatography (ERCP) pancreatitis.
21792081 results suggest that trypsinogen-2 is a more sensitive marker than amylase, and it can be useful in early diagnosis of post-endoscopic retrograde cholangiopancreatography (ERCP) pancreatitis.
More...

AA Sequence

MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQ      1 - 70
VRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESL     71 - 140
ISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGEL    141 - 210
QGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS                                     211 - 247
//

Text Mined References (57)

PMID Year Title
26110235 2015 Association of claudin2 and PRSS1-PRSS2 polymorphisms with idiopathic recurrent acute and chronic pancreatitis: A case-control study from India.
25916077 Correlations between serum trypsinogen-2 and pancreatic cancer.
25253127 2015 Polymorphisms at PRSS1-PRSS2 and CLDN2-MORC4 loci associate with alcoholic and non-alcoholic chronic pancreatitis in a European replication study.
25010489 2014 Tyrosine sulfation of human trypsin steers S2' subsite selectivity towards basic amino acids.
24146905 2013 Autocrine extra-pancreatic trypsin 3 secretion promotes cell proliferation and survival in esophageal adenocarcinoma.
23882137 2013 Trypsin-mediated enzymatic degradation of type II collagen in the human vitreous.
23143602 2012 Common genetic variants in the CLDN2 and PRSS1-PRSS2 loci alter risk for alcohol-related and sporadic pancreatitis.
22909050 2012 Trypsin-2 enhances carcinoma invasion by processing tight junctions and activating ProMT1-MMP.
22481290 2012 Validity of the urinary trypsinogen-2 test in the diagnosis of acute pancreatitis.
22357509 2012 Elevation of urine trypsinogen 2 is an independent risk factor for pancreatic fistula after pancreaticoduodenectomy.
More...