Property Summary

Ligand Count 1
NCBI Gene PubMed Count 54
PubMed Score 0.00
PubTator Score 30.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.200 1.2e-03
lung adenocarcinoma 1.400 1.9e-03
mucosa-associated lymphoid tissue lympho... -2.001 3.4e-02

Protein-protein Interaction (6)

Gene RIF (37)

AA Sequence

MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQ      1 - 70
VRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESL     71 - 140
ISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGEL    141 - 210
QGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS                                     211 - 247
//

Text Mined References (57)

PMID Year Title