Property Summary

NCBI Gene PubMed Count 160
Grant Count 130
R01 Count 79
Funding $14,196,824.96
PubMed Score 551.80
PubTator Score 404.64

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P07477 A1A509 A6NJ71 B2R5I5 Q5NV57 Q7M4N3 Q7M4N4 Q92955 Q9HAN4 Q9HAN5 Q9HAN6 Q9HAN7
Symbols TRP1
TRY1
TRY4
TRYP1

Gene

PANTHER Protein Class (3)

PDB

1FXY   1TRN   2RA3   4WWY   4WXV  

 GWAS Trait (1)

Gene RIF (127)

PMID Text
27129265 Human anionic trypsinogen is controlled by CTRC in a manner that individual natural mutations are unlikely to increase stability enough to promote intra-pancreatic activation.
26658045 Letter/Case Report: high penetrance of the PRSS1 A16V mutation caused by SPINK1 N34S and CFTR TG11-5T co-mutations associated with pancreatitis.
26376395 N29T mutation associated with pancreatitis
26110235 Association of PRSS1 polymorphism with idiopathic recurrent acute pancreatitis and idiopathic chronic pancreatitis.
25981744 We did not find PRSS1 mutation in any patient.
25835118 This study shows that PRSS1, SPINK1 and CFTR mutations do not play a role in alcoholic and idiopathic chronic pancreatitis patients.
25546417 Recombination events between members of the trypsinogen family can generate high-risk PRSS1 alleles.
25383785 In Israel, pediatric as well as adult recurrent acute pancreatitis and chronic pancreatitis are often associated with PRSS1, serine protease inhibitor Kazal type 1, chymotrypsin C, or Cystic Fibrosis Transmembrane Conductance Regulator mutations.
25253127 PRSS1 single nucleotide polymorphism is associated with alcoholic pancreatitis.
25206283 Two novel PRSS1 mutations were identified in Mexican patients with early onset idiopathic recurrent acute pancreatitis.
More...

AA Sequence

MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQ      1 - 70
VRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCL     71 - 140
ISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQL    141 - 210
QGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS                                     211 - 247
//

Text Mined References (163)

PMID Year Title
27129265 2016 Tighter Control by Chymotrypsin C (CTRC) Explains Lack of Association between Human Anionic Trypsinogen and Hereditary Pancreatitis.
26658045 2016 High Penetrance of the PRSS1 A16V Mutation in a Kindred With SPINK1 N34S and CFTR TG11-5T Co-mutations.
26376395 2015 Hereditary Pancreatitis Associated With the N29T Mutation of the PRSS1 Gene in a Brazilian Family: A Case-Control Study.
26110235 2015 Association of claudin2 and PRSS1-PRSS2 polymorphisms with idiopathic recurrent acute and chronic pancreatitis: A case-control study from India.
25981744 2015 Genetic predisposition and its impact on natural history of idiopathic acute and acute recurrent pancreatitis in children.
25835118 2015 Mutation analysis of PRSS1, SPINK1 and CFTR gene in patients with alcoholic and idiopathic chronic pancreatitis: A single center study.
25546417 2015 Gene conversion between cationic trypsinogen (PRSS1) and the pseudogene trypsinogen 6 (PRSS3P2) in patients with chronic pancreatitis.
25383785 2015 Genetic and electrophysiological characteristics of recurrent acute pancreatitis.
25253127 2015 Polymorphisms at PRSS1-PRSS2 and CLDN2-MORC4 loci associate with alcoholic and non-alcoholic chronic pancreatitis in a European replication study.
25206283 2014 PRSS1 and SPINK1 mutations in idiopathic chronic and recurrent acute pancreatitis.
More...