Property Summary

NCBI Gene PubMed Count 59
Grant Count 100
R01 Count 71
Funding $12,138,316.32
PubMed Score 970.75
PubTator Score 199.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -3.100 0.019
psoriasis 2.300 0.000
cutaneous lupus erythematosus 1.600 0.007
medulloblastoma, large-cell 1.400 0.000
non-small cell lung cancer 2.276 0.000
interstitial cystitis -2.400 0.000
cystic fibrosis 1.100 0.002
adult high grade glioma 1.200 0.012
spina bifida -2.127 0.040
ovarian cancer 1.700 0.000

Synonym

Accession P07476 Q5T7P4
Symbols

Gene

IVL

PDB

1EU0  

Gene RIF (35)

PMID Text
24515279 Together, these results suggest that GR modulates involucrin expression of keratinocytes by regulating the intracellular signaling network in a ligand-independent manner.
24252747 over-expression of Nnat was evident along with involucrin and cytokeratin1 expression
23599428 KLF4 is part of a multiprotein complex that interacts that the hINV promoter distal regulatory region to drive differentiation-dependent hINV gene expression in epidermis.
23283814 involucrin is up-regulated in psoriatic keratinocytes
22742591 Compared with the control, the level of expression of the IVL gene in NCTC 2544 cells was increased after 8 h of treatment with hyaluronic acid or Plantaricin A preparations.
22333115 The authors found that HPV 16 E6 but not E7 repressed IVL promoter activity in proliferating human foreskin keratinocyte cells.
22197495 Therefore, together with trichohyalin, the cross-linking due to involucrin is also responsible for the mechanical resistance of the corneous trabeculae present among the empty spaces of the medulla of the human hair.
20208004 expression of the epidermal differentiation complex genes filaggrin and involucrin was strongly decreased directly by IL-13.
19701759 higher expression in the fetal skin than in adult skin
19601998 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGL      1 - 70
PEQECEQQQKEPQEQELQQQHWEQHEEYQKAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVK     71 - 140
RDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQE    141 - 210
GQLELPEQQEGQLELPEQQEGQLELPQQQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQM    211 - 280
GQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQE    281 - 350
GQLEHLEHQEGQLGLPEQQVLQLKQLEKQQGQPKHLEEEEGQLKHLVQQEGQLKHLVQQEGQLEQQERQV    351 - 420
EHLEQQVGQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHLEKQEAQL    421 - 490
ELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQLEQPVFAPAPGQVQDIQPALP    491 - 560
TKGEVLLPVEHQQQKQEVQWPPKHK                                                 561 - 585
//

Text Mined References (61)

PMID Year Title
24515279 2014 Glucocorticoid receptor enhances involucrin expression of keratinocyte in a ligand-independent manner.
24252747 2014 Neuronatin is related to keratinocyte differentiation by up-regulating involucrin.
23599428 2013 Protein kinase C ? increases Kruppel-like factor 4 protein, which drives involucrin gene transcription in differentiating keratinocytes.
23283814 2013 Regulation of involucrin in psoriatic epidermal keratinocytes: the roles of ERK1/2 and GSK-3?.
22742591 2012 The antimicrobial peptide pheromone Plantaricin A increases antioxidant defenses of human keratinocytes and modulates the expression of filaggrin, involucrin, ?-defensin 2 and tumor necrosis factor-? genes.
22333115 2012 Effects of human papillomavirus (HPV) type 16 oncoproteins on the expression of involucrin in human keratinocytes.
22197495 2012 Ultrastructural immunolocalization of involucrin in the medulla and inner root sheath of the human hair.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20208004 2010 Coordinate interaction between IL-13 and epithelial differentiation cluster genes in eosinophilic esophagitis.
More...