Property Summary

NCBI Gene PubMed Count 59
PubMed Score 1006.18
PubTator Score 199.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.700 6.2e-07
adult high grade glioma 1.200 1.2e-02
cutaneous lupus erythematosus 1.600 7.0e-03
cystic fibrosis 1.100 2.3e-03
esophageal adenocarcinoma -3.100 1.9e-02
interstitial cystitis -2.000 3.7e-03
medulloblastoma, large-cell 1.400 5.2e-05
non-small cell lung cancer 2.276 1.3e-09
ovarian cancer 1.700 1.1e-11
spina bifida -2.127 4.0e-02

Gene RIF (35)

AA Sequence

MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGL      1 - 70
PEQECEQQQKEPQEQELQQQHWEQHEEYQKAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVK     71 - 140
RDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQE    141 - 210
GQLELPEQQEGQLELPEQQEGQLELPQQQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQM    211 - 280
GQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQE    281 - 350
GQLEHLEHQEGQLGLPEQQVLQLKQLEKQQGQPKHLEEEEGQLKHLVQQEGQLKHLVQQEGQLEQQERQV    351 - 420
EHLEQQVGQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHLEKQEAQL    421 - 490
ELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQLEQPVFAPAPGQVQDIQPALP    491 - 560
TKGEVLLPVEHQQQKQEVQWPPKHK                                                 561 - 585
//

Text Mined References (61)

PMID Year Title