Property Summary

Ligand Count 15
NCBI Gene PubMed Count 44
PubMed Score 757.43
PubTator Score 1382.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 2.700 2.6e-03
Breast cancer -2.800 5.9e-33
ductal carcinoma in situ -3.600 1.1e-03
ependymoma 3.800 4.3e-06
glioblastoma 1.900 6.4e-03
invasive ductal carcinoma -4.100 1.2e-03
lung adenocarcinoma -1.900 7.7e-11
lung cancer -1.600 6.2e-03
non-small cell lung cancer -1.088 1.6e-07
ovarian cancer -1.300 2.1e-07
psoriasis -1.800 9.3e-37

Gene RIF (12)

AA Sequence

MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVF      1 - 70
DDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGI     71 - 140
AVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLL    141 - 210
LKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK                        211 - 260
//

Text Mined References (50)

PMID Year Title