Property Summary

NCBI Gene PubMed Count 43
Grant Count 38
R01 Count 22
Funding $4,907,692.9
PubMed Score 733.56
PubTator Score 1382.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma 1.900 0.006
posterior fossa group B ependymoma 4.700 0.000
non-small cell lung cancer -1.088 0.000
lung cancer -2.300 0.001
adult high grade glioma 2.700 0.003
lung adenocarcinoma -1.900 0.000
Breast cancer -2.800 0.000
ductal carcinoma in situ -3.600 0.001
invasive ductal carcinoma -4.100 0.001
ovarian cancer -1.300 0.000
psoriasis -1.800 0.000

Gene RIF (11)

PMID Text
24838180 this study detected the formation and colocalization of 6-nitrotryptophan-containing proteins and CAIII in the skin of atopic dermatitis patients, not only in the lesional part but also in the nonlesional part, through histochemical analyses
23981757 Report that anti-CAIII antibodies may be useful for diagnosing microscopic polyangiitis.
23049597 The generation of CA III and IV autoantibodies, antioxidant enzymes, and cytokines might influence each other.
22797148 The carbonic anhydrase CA3 isoform displayed an increased abundance during muscle aging, which was independently verified by immunoblotting of differently aged human skeletal muscle samples.
19301202 The level of CAIII is specifically insufficient in the skeletal muscle of myasthenia gravis patients.
18444244 CAIII promotes transformation and invasion capability in hepatoma cells through FAK signaling pathway.
18322545 CAIII expression is upregulated in kidney cortex samples from the end-stage kidney of a patient with Dent's disease owing to the G506E mutation of CLCN5
12745799 myoglobin/carbonic anhydrase III ratio in the blood proved to be a more specific indicator for myocardial damage than myoglobin alone after myocardial infarction.
12484342 Proton transfer within the active-site cavity of carbonic anhydrase III
12171926 Data show that inserting histidine residues into the active site cavity of carbonic anhydrase II or III results in rates of proton transfer to the zinc-bound hydroxide that are antagonistic or suppressive with respect to the corresponding single mutants.
More...

AA Sequence

MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVF      1 - 70
DDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGI     71 - 140
AVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLL    141 - 210
LKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK                        211 - 260
//

Text Mined References (49)

PMID Year Title
24838180 2014 Importance of tryptophan nitration of carbonic anhydrase III for the morbidity of atopic dermatitis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23981757 2013 Anti-carbonic anhydrase III autoantibodies in vasculitis syndrome.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23049597 2012 Carbonic anhydrases III and IV autoantibodies in rheumatoid arthritis, systemic lupus erythematosus, diabetes, hypertensive renal disease, and heart failure.
22797148 2012 Mass spectrometry-based proteomic analysis of middle-aged vs. aged vastus lateralis reveals increased levels of carbonic anhydrase isoform 3 in senescent human skeletal muscle.
19301202 2009 Carbonic anhydrase III is insufficient in muscles of myasthenia gravis patients.
19206230 2009 Non-zinc mediated inhibition of carbonic anhydrases: coumarins are a new class of suicide inhibitors.
19186056 2009 A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases.
18618712 2009 Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide.
More...