Property Summary

NCBI Gene PubMed Count 73
PubMed Score 84.48
PubTator Score 63.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (49)

Disease Z-score Confidence
Lissencephaly 61 3.068 1.5
Acute lymphoid leukemia 25
Anaplastic large T-cell systemic maligna... 10 
Breast cancer 3,094
Burkitt's lymphoma 15
CORTICAL DYSPLASIA, COMPLEX, WITH OTHER ... 1 
Carcinoma of breast 11
Carcinoma of female breast 20
Diffuse non-Hodgkin's lymphoma, large ce... 12 
Duchenne muscular dystrophy 602
Follicular non-Hodgkin's lymphoma 17
Gestational trophoblastic neoplasia 14
HER2-positive carcinoma of breast 10
Hodgkin's disease 18
Hypertensive disorder 58
Kaposi's sarcoma 20
Langerhans cell histiocytosis, dissemina... 10 
Liposarcoma 20
Malignant tumor of head and/or neck 15
Malignant tumor of ovary 25
Malignant tumor of prostate 11
Malignant tumor of stomach 12
Malignant tumor of testis 11
Metastatic Breast Carcinoma 21
Metastatic Prostate Carcinoma 18
Multiple myeloma 1,327
Mycosis fungoides 28
Nephroblastoma 45
Neuroblastoma 78
Non-Hodgkin's lymphoma 22
Ocular hypertension 27
Open-angle glaucoma 26
Rhabdomyosarcoma 29
Secondary malignant neoplasm of pancreas 10
Transitional cell carcinoma 18
Waldenstrons macroglobulinemia 765
adult high grade glioma 2,148
atypical teratoid/rhabdoid tumor 1,095
colon cancer 1,475
lung adenocarcinoma 2,713
lung cancer 4,466
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non primary Sjogren syndrome sicca 840
non-small cell lung cancer 2,798
ovarian cancer 8,484
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
sonic hedgehog group medulloblastoma 1,482

Expression

Synonym

Accession P07437 P05218 Q8WUC1 Q9CY33
Symbols M40
TUBB1
TUBB5
CDCBM6
CSCSC1
OK/SW-cl.56

Gene

PDB

3QNZ   3QO0  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2205 screening 1625 / 0 / 194228 HCS assay for microtubule stabilizers

Gene RIF (34)

PMID Text
26165356 Data show that tubulin phosphorylation and acetylation play important roles in the control of microtubule assembly and stability.
26081685 Data suggest a looser binding of the ligand in tubulin mutants.
26016807 Data suggest that, while lacking a stable structure, NFL-TBS.40-63 peptide (a peptide derived from light neurofilament protein) preferentially binds on a specific single site located near C-terminal end of beta-tubulin.
24275654 Data indicate that leucine-rich repeat kinase 2 (LRRK2) selectively interacts with three beta-tubulin isoforms: TUBB, TUBB4, and TUBB6.
24161989 mechanism of binding and stabilization of microtubules in mammalian cells can be effectively modeled in yeast and also having the advantage of lacking any beta-tubulin isotypes that can complicate interpretation of experiments in mammalian cells.
24099319 Citrullination of TUBB is associated with neoplasms.
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
23818224 Studies suggest that tubulin-interactive agents have the potential to play a significant role in the fight against cancer.
23285209 Centaurin-alpha interacts with beta-tubulin and stabilizes microtubules.
23246003 results provide insight into the functional repertoire of the tubulin gene family, specifically implicating TUBB5 in embryonic neurogenesis and microcephaly
More...

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATAEEEEDFGEEAEEEA                                                  421 - 444
//

Text Mined References (82)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
26637975 2015 Mutations in Either TUBB or MAPRE2 Cause Circumferential Skin Creases Kunze Type.
26165356 2015 Proteomic Profiling and Functional Characterization of Multiple Post-Translational Modifications of Tubulin.
26081685 2015 Structural basis for drug resistance conferred by ?-tubulin mutations: a molecular modeling study on native and mutated tubulin complexes with epothilone B.
26016807 2015 Investigating the Structural Variability and Binding Modes of the Glioma Targeting NFL-TBS.40-63 Peptide on Tubulin.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24375412 2014 Programmed cell death protein 5 interacts with the cytosolic chaperonin containing tailless complex polypeptide 1 (CCT) to regulate ?-tubulin folding.
24275654 2014 A direct interaction between leucine-rich repeat kinase 2 and specific ?-tubulin isoforms regulates tubulin acetylation.
More...