Property Summary

Ligand Count 15
NCBI Gene PubMed Count 75
PubMed Score 88.34
PubTator Score 63.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Michelin tire baby syndrome 2
Disease Target Count Z-score Confidence
Lissencephaly 69 3.033 1.5

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.200 1.4e-04
atypical teratoid / rhabdoid tumor 1.600 2.9e-08
Breast cancer 4.100 2.2e-02
colon cancer 1.400 3.1e-02
Duchenne muscular dystrophy 1.386 2.3e-07
group 3 medulloblastoma 1.500 1.6e-05
lung adenocarcinoma 1.319 1.5e-05
lung cancer 1.200 1.3e-03
medulloblastoma, large-cell 1.800 5.4e-06
Multiple myeloma 1.550 7.6e-04
nasopharyngeal carcinoma 1.200 2.2e-06
non primary Sjogren syndrome sicca 1.300 3.9e-02
non-small cell lung cancer 1.199 1.3e-22
ovarian cancer -1.500 1.2e-05
primary pancreatic ductal adenocarcinoma 1.255 1.4e-02
primitive neuroectodermal tumor 1.500 1.2e-04
Waldenstrons macroglobulinemia 1.328 2.1e-02

Gene RIF (34)

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATAEEEEDFGEEAEEEA                                                  421 - 444
//

Text Mined References (84)

PMID Year Title