Property Summary

Ligand Count 375
NCBI Gene PubMed Count 161
PubMed Score 361.88
PubTator Score 233.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis 1.200 2.0e-03
atypical teratoid / rhabdoid tumor 1.200 2.0e-05
diabetes mellitus -1.200 1.2e-03
interstitial cystitis -1.400 1.3e-04
osteosarcoma -1.234 1.1e-03

Protein-protein Interaction (15)

Gene RIF (113)

AA Sequence

MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGY      1 - 70
KDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQS     71 - 140
FQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGST    141 - 210
SEGFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAK    211 - 280
QVNYRGQVVSLIRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEI    281 - 350
CNLTPDALKSRTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV    351 - 420
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINLREVSTRFRLP    421 - 490
PGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSEEEIDENFKALFRQLAGEDME    491 - 560
ISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRDGNGKLGLVEFNILWNRIRNYLSIFRKFDLD    561 - 630
KSGSMSAYEMRMAIESAGFKLNKKLYELIITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVV    631 - 700
TFDLFKWLQLTMFA                                                            701 - 714
//

Text Mined References (167)

PMID Year Title