Property Summary

NCBI Gene PubMed Count 146
Grant Count 19
R01 Count 4
Funding $1,615,562.58
PubMed Score 331.82
PubTator Score 233.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.234 0.001
atypical teratoid / rhabdoid tumor 1.200 0.000
Atopic dermatitis 1.200 0.002
diabetes mellitus -1.200 0.001
interstitial cystitis -1.400 0.000

Gene RIF (103)

PMID Text
27036949 This study demonstrated that Upregulation of calpain activity precedes tau phosphorylation and loss of synaptic proteins in Alzheimer's disease brain.
26974309 the calpain-dependent cleavage of Nav1.6 channels expressed in human embryonic kidney (HEK) 293 cells caused the upregulation of I(NaP)
26317226 Increased mu-Calpain Activity in Blasts of Common B-Precursor Childhood Acute Lymphoblastic Leukemia Correlates with Their Lower Susceptibility to Apoptosis.
26284543 NOS stimulation via PI3K, calpain proteases, and SIRT1-dependent deacetylation downstream from VEGFR2 activation contributes to these vasodilator responses.
26172506 Data indicate that calpain is responsible for processing translation termination factor eRF3 into its IAP-binding isoform p-eRF3.
26063807 Junctophilin-2 is cleaved by calpain at multiple sites, resulting in dysfunctional junctophilin-2 truncations.
25918155 findings suggest that truncation/activation of Dyrk1A by Ca(2+)/calpain I might contribute to Tau pathology via promotion of exon 10 exclusion and hyperphosphorylation of Tau in AD brain
25476568 The results of this study indicated that reductions in kallikrein-6 and calpain-1 may contribute to the accumulation of alpha-synuclein in DLB.
25336645 CAPN1 anchors to two NCX1 regions and cleaves at methionine-369, leading to NCX1 inactivation in heart failure.
25309925 5-LOX inhibition reduced apoptotic death, restored the initial IL-2/INF-gamma ratio, and more importantly reverted micro-calpain activation induced by simulated microgravity.
More...

AA Sequence

MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGY      1 - 70
KDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQS     71 - 140
FQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGST    141 - 210
SEGFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAK    211 - 280
QVNYRGQVVSLIRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEI    281 - 350
CNLTPDALKSRTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV    351 - 420
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINLREVSTRFRLP    421 - 490
PGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSEEEIDENFKALFRQLAGEDME    491 - 560
ISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRDGNGKLGLVEFNILWNRIRNYLSIFRKFDLD    561 - 630
KSGSMSAYEMRMAIESAGFKLNKKLYELIITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVV    631 - 700
TFDLFKWLQLTMFA                                                            701 - 714
//

Text Mined References (156)

PMID Year Title
27036949 2016 Upregulation of calpain activity precedes tau phosphorylation and loss of synaptic proteins in Alzheimer's disease brain.
26974309 2016 Cleavage of Na(+) channels by calpain increases persistent Na(+) current and promotes spasticity after spinal cord injury.
26317226 2015 Increased ?-Calpain Activity in Blasts of Common B-Precursor Childhood Acute Lymphoblastic Leukemia Correlates with Their Lower Susceptibility to Apoptosis.
26284543 2015 VEGF Receptor-2-Linked PI3K/Calpain/SIRT1 Activation Mediates Retinal Arteriolar Dilations to VEGF and Shear Stress.
26172506 2015 Calpain mediates processing of the translation termination factor eRF3 into the IAP-binding isoform p-eRF3.
26063807 2015 Molecular Determinants of Calpain-dependent Cleavage of Junctophilin-2 Protein in Cardiomyocytes.
25918155 2015 Truncation and Activation of Dual Specificity Tyrosine Phosphorylation-regulated Kinase 1A by Calpain I: A MOLECULAR MECHANISM LINKED TO TAU PATHOLOGY IN ALZHEIMER DISEASE.
25476568 2014 Accumulation of ?-synuclein in dementia with Lewy bodies is associated with decline in the ?-synuclein-degrading enzymes kallikrein-6 and calpain-1.
25336645 2014 Molecular basis of calpain cleavage and inactivation of the sodium-calcium exchanger 1 in heart failure.
25309925 2014 A functional interplay between 5-lipoxygenase and ?-calpain affects survival and cytokine profile of human Jurkat T lymphocyte exposed to simulated microgravity.
More...