Property Summary

NCBI Gene PubMed Count 28
PubMed Score 34.01
PubTator Score 21.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.182 1.5e-02

Protein-protein Interaction (8)

Gene RIF (10)

AA Sequence

MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRA      1 - 70
EATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYL     71 - 140
ERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR            141 - 202
//

Text Mined References (31)

PMID Year Title