Property Summary

NCBI Gene PubMed Count 296
Grant Count 201
R01 Count 111
Funding $23,552,012.48
PubMed Score 579.97
PubTator Score 608.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.665 0.000

Synonym

Accession P07359 E7ES66 Q14441 Q16469 Q8N1F3 Q8NG39 Q9HDC7 Q9UEK1 Q9UQS4 GP-Ib alpha
Symbols BSS
GP1B
VWDP
CD42B
GPIbA
BDPLT1
BDPLT3
DBPLT3
GPIbalpha
CD42b-alpha

Gene

PDB

1OOK   1P8V   3PMH   4CH2   4CH8   2BP3   1GWB   1K13   1M0Z   1M10   1P9A   1QYY   1SQ0   1U0N   3P72   4C2A   4C2B   4MGX   4YR6  

 GWAS Trait (1)

Gene RIF (224)

PMID Text
26569550 Both GPIbalpha and PAR4 are required for thrombin-induced reactive oxygen species formation
26539867 There is a prevalence of Thr145Met and T(-5)C GP Iba polymorphiams in patients with atherotrombotic stroke due to macroangiopathy.
26341739 Hemoglobin interaction with GP1balpha induces platelet activation and apoptosis: a novel mechanism associated with intravascular hemolysis.
26213126 Our results reveal the molecular mechanism of collagen-regulated, A1-mediated platelet adhesion enhancement.
26191334 Report no relationship, between polymorphisms of platelet membrane glycoprotein Ibalpha and risk of coronary heart disease in Chinese Han population.
26044173 Molecular analysis demonstrated a novel homozygous c.800C>G substitution in GP1BA exon 2 leading to a serine 267 Ter stop codon in all 3 siblings
25810255 Data show that force can switch the kinetics of bond formation between A1 domain of von Willebrand factor (VWF) and glycoprotein Ibalpha (GPIbalpha).
25341886 Whereas VWF-D'D3 is the major regulator of soluble VWF binding to platelet GpIbalpha, both the D'D3-domain and N-terminal peptide regulate platelet translocation and thrombus formation.
25231551 Data indicate that GPIbalpha clustering induced by anti-GPIbalpha N-terminus antibody causes integrin alphaIIbbeta3-dependent platelet aggregation, phagocytosis, and rapid platelet clearance in the liver.
24749250 Increased mean platelet volume values correlated with increased platelet aggregation activity and enhanced GP IIb-IIIa and GP Ib expression.
More...

AA Sequence

MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPY      1 - 70
TRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLG     71 - 140
ELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGS    141 - 210
HLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGC    211 - 280
PTLGDEGDTDLYDYYPEEDTEGDKVRATRTVVKFPTKAHTTPWGLFYSWSTASLDSQMPSSLHPTQESTK    281 - 350
EQTTFPPRWTPNFTLHMESITFSKTPKSTTEPTPSPTTSEPVPEPAPNMTTLEPTPSPTTPEPTSEPAPS    351 - 420
PTTPEPTSEPAPSPTTPEPTSEPAPSPTTPEPTPIPTIATSPTILVSATSLITPKSTFLTTTKPVSLLES    421 - 490
TKKTIPELDQPPKLRGVLQGHLESSRNDPFLHPDFCCLLPLGFYVLGLFWLLFASVVLILLLSWVGHVKP    491 - 560
QALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSA    561 - 630
LSQGRGQDLLSTVSIRYSGHSL                                                    631 - 652
//

Text Mined References (299)

PMID Year Title
26569550 2015 Thrombin-induced reactive oxygen species generation in platelets: A novel role for protease-activated receptor 4 and GPIb?.
26539867 [The molecular mechanisms of platelets activation in patients with cerebrovascular disease].
26341739 2015 Hemoglobin interaction with GP1b? induces platelet activation and apoptosis: a novel mechanism associated with intravascular hemolysis.
26213126 2015 Von Willebrand factor-A1 domain binds platelet glycoprotein Ib? in multiple states with distinctive force-dependent dissociation kinetics.
26191334 2015 Association between polymorphisms of platelet membrane glycoprotein Ib? and risk of coronary heart disease in Han Chinese, Henan, China.
26044173 2015 A Novel Homozygous c.800C>G Substitution in GP1BA Exon 2 in a Kuwaiti Family with Bernard-Soulier Syndrome.
25810255 2015 Force-induced on-rate switching and modulation by mutations in gain-of-function von Willebrand diseases.
25666618 2015 A mechanism of global shape-dependent recognition and phosphorylation of filamin by protein kinase A.
25370924 2015 Clinical phenotype in heterozygote and biallelic Bernard-Soulier syndrome--a case control study.
25341886 2014 Platelet GpIba binding to von Willebrand Factor under fluid shear:contributions of the D?D3-domain, A1-domain flanking peptide and O-linked glycans.
More...