Property Summary

NCBI Gene PubMed Count 50
Grant Count 4
R01 Count 4
Funding $498,742.34
PubMed Score 35.44
PubTator Score 129.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.744 0.019
non-small cell lung cancer -2.082 0.000
lung cancer -1.300 0.001
lung adenocarcinoma -1.100 0.000
lung carcinoma -1.400 0.000
ovarian cancer 1.100 0.000

Synonym

Accession P07358 A1L4K7
Symbols C82

Gene

C8B

PDB

3OJY  

Gene RIF (11)

PMID Text
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19864026 Complement C5b-9 induce a JNK/Bid-dependent and JNK-independent necrotic cell death.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19344414 Observational study of gene-disease association. (HuGE Navigator)
19162005 Cell cycle induction by C5b-9 in aortic endothelial cells is RGC-32 dependent and this is in part through regulation of Akt and growth factor release.
18842294 Observational study of gene-disease association. (HuGE Navigator)
16618117 results indicate that the principal binding site for C9 lies within the MACPF domain of C8alpha; they also suggest this site and the binding sites for C8beta and C8gamma are distinct
12413696 C8 alpha and C8 beta have correspondingly similar roles in MAC-mediated lysis of erythrocytes and bacterial killing. C8 gamma is not required for complement-mediated killing of Gram-negative bacteria.
More...

AA Sequence

MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTLMPIDCELSSW      1 - 70
SSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLC     71 - 140
NGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRF    141 - 210
RKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIR    211 - 280
RTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVL    281 - 350
GGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV    351 - 420
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMK    421 - 490
QALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGR    491 - 560
RKTRQRQCNNPPPQNGGSPCSGPASETLDCS                                           561 - 591
//

Text Mined References (54)

PMID Year Title
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21454577 2011 Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement.
21073882 2011 Structure of human complement C8, a precursor to membrane attack.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19864026 2009 Involvement of the c-jun N-terminal kinases JNK1 and JNK2 in complement-mediated cell death.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
More...