Property Summary

NCBI Gene PubMed Count 51
PubMed Score 37.00
PubTator Score 129.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
lung adenocarcinoma -1.100 3.1e-13
lung cancer -1.300 5.6e-04
lung carcinoma -1.400 2.0e-10
non-small cell lung cancer -2.082 3.4e-19
ovarian cancer 1.100 5.0e-12
pancreatic ductal adenocarcinoma liver m... -2.744 1.9e-02

Gene RIF (11)

AA Sequence

MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTLMPIDCELSSW      1 - 70
SSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLC     71 - 140
NGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRF    141 - 210
RKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIR    211 - 280
RTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVL    281 - 350
GGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV    351 - 420
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMK    421 - 490
QALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGR    491 - 560
RKTRQRQCNNPPPQNGGSPCSGPASETLDCS                                           561 - 591
//

Text Mined References (55)

PMID Year Title