Property Summary

NCBI Gene PubMed Count 236
Grant Count 134
R01 Count 73
Funding $13,783,983.01
PubMed Score 2823.82
PubTator Score 1805.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 1.100 0.012
acute quadriplegic myopathy 1.466 0.000
lung cancer -1.500 0.001
diabetes mellitus -1.100 0.019
subependymal giant cell astrocytoma 1.772 0.014
invasive ductal carcinoma 1.192 0.000
lung carcinoma -1.100 0.000
breast carcinoma 1.200 0.000
mucosa-associated lymphoid tissue lympho... 1.215 0.050
ovarian cancer 2.200 0.000

Synonym

Accession P07339 Q6IB57
Symbols CPSD
CLN10
HEL-S-130P

Gene

PANTHER Protein Class (3)

PDB

1LYA   1LYB   1LYW   4OBZ   4OC6   4OD9  

Gene RIF (185)

PMID Text
26718887 Data indicate that cathepsin D (CD) protein is elevated in the retinas of diabetic mice and serum of human patients with diabetic macular edema (DME).
26519755 study provides evidence that hTERT overexpression is responsible for the upregulation of the cysteine protease cathepsin D by regulating EGR-1 to activate invasiveness in cancer progression
26507101 Fibroblasts from Niemann-Pick type C (NPC) disease patients with low levels of NPC1 protein have high amounts of procathepsin D but reduced quantities of the mature protein, thus showing a diminished cathepsin D activity.
26448324 Transcellular transmission of alpha-synuclein aggregates is increased in CTSD mutated cells.
26351775 Variations in CTSD and MnSOD showed no association with the development of Alzheimer's Disease, whereas the presence of the Ala224Val polymorphism in CTSD had a positive association with the development of AD
26344002 Fenhexamid and cyprodinil can promote ovarian cancer metastasis by increasing the protein expression of cathepsin D via an estrogen receptor dependent pathway.
26203049 A proteomics workflow identified CTSD as an over-expressed protein in osteosarcomas and pulmonary metastases and may thus serve as a new biomarker for individualized treatment regimes for patients with osteosarcomas, even at metastastic stage.
26183398 Data show that co-silencing of tricho-rhino-phalangeal-syndrome (TRPS1) and cathepsin D (Cath-D) in breast cancer cells (BCC) affects the transcription of cell cycle and proliferation.
26086961 the clues provided by the yeast model unveiled a novel CatD function in the degradation of damaged mitochondria when autophagy is impaired, which protects colorectal cancer cells from acetate-induced apoptosis.
26018151 Human Herpesvirus 8-encoded viral interleukin-6 promotes endoplasmic reticulum-associated degradation of procathepsin D.
More...

AA Sequence

MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEV      1 - 70
LKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDI     71 - 140
HYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNN    141 - 210
VLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVA    211 - 280
SGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLS    281 - 350
PEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL            351 - 412
//

Text Mined References (241)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26718887 2016 Cathepsin D: an M?-derived factor mediating increased endothelial cell permeability with implications for alteration of the blood-retinal barrier in diabetic retinopathy.
26519755 2016 Human telomerase reverse transcriptase (hTERT) promotes cancer invasion by modulating cathepsin D via early growth response (EGR)-1.
26507101 2016 Identification of lysosomal Npc1-binding proteins: Cathepsin D activity is regulated by NPC1.
26448324 2015 Haploinsufficiency of cathepsin D leads to lysosomal dysfunction and promotes cell-to-cell transmission of ?-synuclein aggregates.
26351775 2015 Positive Association of the Cathepsin D Ala224Val Gene Polymorphism With the Risk of Alzheimer's Disease.
26344002 2015 Effect of fenhexamid and cyprodinil on the expression of cell cycle- and metastasis-related genes via an estrogen receptor-dependent pathway in cellular and xenografted ovarian cancer models.
26203049 2015 Increased cathepsin D protein expression is a biomarker for osteosarcomas, pulmonary metastases and other bone malignancies.
26183398 2015 Nuclear cathepsin D enhances TRPS1 transcriptional repressor function to regulate cell cycle progression and transformation in human breast cancer cells.
26086961 2015 Cathepsin D protects colorectal cancer cells from acetate-induced apoptosis through autophagy-independent degradation of damaged mitochondria.
More...