Property Summary

Ligand Count 550
NCBI Gene PubMed Count 247
PubMed Score 2866.77
PubTator Score 1805.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Neuronal ceroid lipofuscinosis 10 4

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.466 2.8e-09
breast carcinoma 1.200 1.3e-10
diabetes mellitus -1.100 1.9e-02
glioblastoma 1.100 1.2e-02
invasive ductal carcinoma 1.192 9.5e-05
lung cancer -1.500 5.6e-04
lung carcinoma -1.100 9.8e-20
mucosa-associated lymphoid tissue lympho... 1.215 5.0e-02
ovarian cancer 2.200 5.4e-06
subependymal giant cell astrocytoma 1.772 1.4e-02

Gene RIF (196)

AA Sequence

MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEV      1 - 70
LKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDI     71 - 140
HYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNN    141 - 210
VLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVA    211 - 280
SGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLS    281 - 350
PEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL            351 - 412
//

Text Mined References (253)

PMID Year Title