Property Summary

NCBI Gene PubMed Count 160
Grant Count 440
R01 Count 274
Funding $47,403,348.85
PubMed Score 1355.83
PubTator Score 552.50

Knowledge Summary

Patent (108,131)

Expression

  Differential Expression (13)

Synonym

Accession P07333 B5A955 D3DQG2 Q6LDW5 Q6LDY4 Q86VW7
Symbols FMS
CSFR
FIM2
HDLS
C-FMS
CD115
CSF-1R
M-CSF-R

Gene

PDB

3BEA   4DKD   3DPK   3KRJ   3KRL   4WRL   4WRM   2I0V   2I0Y   2I1M   2OGV   3LCD   3LCO   4HW7   4LIQ   4R7H   4R7I  

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Michael McManus Genetic interaction screen

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (117)

PMID Text
27239844 The frequencies of the rare alleles of CCR2, ITGB3, and 3'UTR of c-fms in the Old Believers are lower than in the sample of Novosibirsk Russians, and the rare allele of DBH is more frequent
26743272 The aim of this study was to compare the expression of CSF-1R in nasopharyngeal carcinoma to nasopharyngitis.
26642091 peripheral nerve injury induced de novo expression of colony-stimulating factor 1 (CSF1) in injured sensory neurons. CSF1 was transported to the spinal cord, where it targeted the microglial CSF1 receptor (CSF1R).
26467457 High CSF-1R expression is associated with Clear Cell Renal Cell Carcinoma.
26443621 All 4 hereditary diffuse leukoencephalopathy with axonal spheroids patients had a different single nucleotide mutation in the cytoplasmic part of the gene. Different mutations lead to different levels of depletion of nonclassical slan-positive monocytes.
26437001 Assessing serum levels of WFA(+) -CSF1R has diagnostic value for predicting carcinogenesis and the survival of LC patients.
26235028 Data show crystal structures of CSF1-CSF1R ternary complexes, and propose a mechanism for their cooperative action that relies on the adoption by dimeric CSF-1 of an active conformational state and homotypic receptor interactions.
26179200 Report treatment of diffuse-type tenosynovial giant cell tumour of the soft tissue using CSF1R inhibition with emactuzumab.
26066800 CSF1R pathway activation was evident in the cHL and inactivation of this pathway could be a potential therapeutic target in cHL cases.
25935893 CSF1R mutations account for 10% of idiopathic adult onset leukodystrophies.
More...

AA Sequence

MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILS      1 - 70
TNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSL     71 - 140
VRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPA    141 - 210
ELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVA    211 - 280
SNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPK    281 - 350
LANATTKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA    351 - 420
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHNQTYECRAHNS    421 - 490
VGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKYKQKPKYQVRWKIIESYEGNS    491 - 560
YTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEAL    561 - 630
MSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYK    631 - 700
NIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLA    701 - 770
SKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS    771 - 840
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFL    841 - 910
QEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIAQPLLQPNNYQFC            911 - 972
//

Text Mined References (178)

PMID Year Title
27239844 [Gene Polymorphism of the c-fms, ITGB3,CCR2, and DBH genes in the populations of old believers of the Tyumen oblast and Russian residents of Novosibirsk].
26743272 2015 Overexpression of CSF-1R in nasopharyngeal carcinoma.
26642091 2016 Injured sensory neuron-derived CSF1 induces microglial proliferation and DAP12-dependent pain.
26467457 2016 High Expression of Colony-Stimulating Factor 1 Receptor Associates with Unfavorable Cancer-Specific Survival of Patients with Clear Cell Renal Cell Carcinoma.
26443621 2015 slan-defined subsets of CD16-positive monocytes: impact of granulomatous inflammation and M-CSF receptor mutation.
26437001 2016 A novel glycobiomarker, Wisteria floribunda agglutinin macrophage colony-stimulating factor receptor, for predicting carcinogenesis of liver cirrhosis.
26235028 2015 Structure and Assembly Mechanism of the Signaling Complex Mediated by Human CSF-1.
26179200 2015 CSF1R inhibition with emactuzumab in locally advanced diffuse-type tenosynovial giant cell tumours of the soft tissue: a dose-escalation and dose-expansion phase 1 study.
26066800 2015 CSF1R Protein Expression in Reactive Lymphoid Tissues and Lymphoma: Its Relevance in Classical Hodgkin Lymphoma.
25935893 2016 Hereditary leukoencephalopathy with axonal spheroids: a spectrum of phenotypes from CNS vasculitis to parkinsonism in an adult onset leukodystrophy series.
More...