Property Summary

Ligand Count 403
NCBI Gene PubMed Count 173
PubMed Score 1432.86
PubTator Score 552.50

Knowledge Summary

Patent (108,131)

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Hematologic cancer 12 0.0 0.7
Immune system cancer 140 0.0 0.7
Disease Target Count Z-score Confidence
Brain cancer 30 0.0 2.1
Disease Target Count Z-score Confidence
Cancer 2499 4.954 2.5

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -1.683 8.1e-04
astrocytic glioma 1.700 1.1e-02
Astrocytoma, Pilocytic 1.300 8.3e-05
Becker muscular dystrophy 1.094 1.2e-04
Duchenne muscular dystrophy 1.450 1.1e-10
glioblastoma 1.400 8.7e-03
group 3 medulloblastoma -2.100 2.4e-04
invasive ductal carcinoma 1.378 2.7e-03
limb girdle muscular dystrophy 2A 1.108 1.2e-05
lung carcinoma -1.200 1.1e-15
medulloblastoma, large-cell -1.400 5.2e-05
ovarian cancer -1.100 1.9e-04
subependymal giant cell astrocytoma 1.831 1.3e-02

Gene RIF (123)

AA Sequence

MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILS      1 - 70
TNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSL     71 - 140
VRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPA    141 - 210
ELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVA    211 - 280
SNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPK    281 - 350
LANATTKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA    351 - 420
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHNQTYECRAHNS    421 - 490
VGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKYKQKPKYQVRWKIIESYEGNS    491 - 560
YTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEAL    561 - 630
MSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYK    631 - 700
NIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLA    701 - 770
SKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS    771 - 840
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFL    841 - 910
QEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIAQPLLQPNNYQFC            911 - 972
//

Text Mined References (191)

PMID Year Title