Property Summary

Ligand Count 5
NCBI Gene PubMed Count 76
PubMed Score 1109.25
PubTator Score 40.15

Knowledge Summary

Patent (46,744)

TINX Plot

  Disease (5)

Disease Target Count P-value
osteosarcoma 7950 5.0e-08
tuberculosis 2010 5.1e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 3.477 1.7
Disease Target Count Z-score Confidence
Xeroderma pigmentosum group D 33 3.262 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.502 5.0e-08
tuberculosis 1.300 5.1e-05

Gene RIF (27)

AA Sequence

MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPIS      1 - 70
QSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQWQQLQQELTKTHSQDIEKLKS     71 - 140
QYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLR    141 - 210
SLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTF    211 - 280
DESLLEEGEPLEPGELQLNELTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRER    281 - 350
VQLLGKRQVLQEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGR    351 - 420
TPTLEILKSHISGIFRPKFSLPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESQGKQE    421 - 490
YVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHRAVPKDKWVLNHED    491 - 560
LVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDLKAKFLQEARILKQYSHPNIVRLIGVCTQKQ    561 - 630
PIYIVMELVQGGDFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKIS    631 - 700
DFGMSREEADGVYAASGGLRQVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTR    701 - 770
EFVEKGGRLPCPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR                      771 - 822
//

Text Mined References (86)

PMID Year Title