Property Summary

NCBI Gene PubMed Count 76
Grant Count 140
R01 Count 90
Funding $15,946,861.14
PubMed Score 985.43
PubTator Score 40.15

Knowledge Summary

Patent (46,744)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.502 0.000
tuberculosis 1.300 0.000

Synonym

Gene

FES

PDB

1WQU   2DCR   3BKB   3CBL   3CD3   4DYL   4E93  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (27)

PMID Text
23404507 analysis of the JAK-Fes-phospholipase D signaling pathway that is enhanced in highly proliferative breast cancer cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20117079 FES kinase is a mediator of wild-type KIT signalling implicated in cell migration.
20030920 c-fes gene expression was found in myeloid leukemias, whereas low or no expression in lymphocytic leukemias.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19885553 FGF-2 activates Fes via the second coiled-coil domain, leading to lamellipodium formation and chemotaxis by endothelial cells
19865112 Observational study of gene-disease association. (HuGE Navigator)
19464057 Observational study of gene-disease association. (HuGE Navigator)
19382747 c-Fes oligomerization is independent of activation; data suggest that conformational changes, rather than oligomerization, govern c-Fes kinase activation and downstream signaling in vivo.
19082481 Downregulation of the c-Fes protein-tyrosine kinase inhibits the proliferation of renal carcinoma.
More...

AA Sequence

MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPIS      1 - 70
QSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQWQQLQQELTKTHSQDIEKLKS     71 - 140
QYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLR    141 - 210
SLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTF    211 - 280
DESLLEEGEPLEPGELQLNELTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRER    281 - 350
VQLLGKRQVLQEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGR    351 - 420
TPTLEILKSHISGIFRPKFSLPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESQGKQE    421 - 490
YVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHRAVPKDKWVLNHED    491 - 560
LVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDLKAKFLQEARILKQYSHPNIVRLIGVCTQKQ    561 - 630
PIYIVMELVQGGDFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKIS    631 - 700
DFGMSREEADGVYAASGGLRQVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTR    701 - 770
EFVEKGGRLPCPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR                      771 - 822
//

Text Mined References (86)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23404507 2013 A new signaling pathway (JAK-Fes-phospholipase D) that is enhanced in highly proliferative breast cancer cells.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21622225 2011 Structure and regulation of the c-Fes protein-tyrosine kinase.
21563194 2012 Pathological significance and predictive value for biochemical recurrence of c-Fes expression in prostate cancer.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...