Property Summary

NCBI Gene PubMed Count 44
Grant Count 33
R01 Count 13
Funding $1,419,657.92
PubMed Score 259.18
PubTator Score 171.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma -1.800 0.000
lung carcinoma -2.300 0.000
non-small cell lung carcinoma -1.300 0.000
ulcerative colitis -1.500 0.000
psoriasis -1.800 0.000

Gene RIF (29)

PMID Text
24762066 Data indicate that the up-regulation of aldehyde dehydrogenase-1 (ALDH1) after neoadjuvant chemotherapy (NAC) predicts poor survival in locally advanced breast cancer.
23891545 Unde-rexpression of the ADH1 gene, which influences the transformation of the extracellular matrix, plays a probable role in the etiology of uterine fibroid.
23769565 high levels of ADH1 transcription are implicated in fluconazole resistance in C. albicans and that the mRNA expression levels of ADH1 are positively correlated with those of CDR1, CDR2 and FLU1.
23468174 common ADH variants conferred risk for both schizophrenia in African-Americans and autism in European-Americans.
20872569 High ADH1 is associated with endometrial cancer.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19687126 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVTPLPVILGHEA      1 - 70
AGIVESVGEGVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHH     71 - 140
FLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAIM    141 - 210
GCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL    211 - 280
LCCHEACGTSVIVGVPPDSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHV    281 - 350
LPFEKINEGFDLLHSGKSIRTILMF                                                 351 - 375
//

Text Mined References (48)

PMID Year Title
24762066 2014 Changes in aldehyde dehydrogenase-1 expression during neoadjuvant chemotherapy predict outcome in locally advanced breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23891545 2013 The role of the alcohol dehydrogenase-1 (ADH1) gene in the pathomechanism of uterine leiomyoma.
23769565 2013 Alcohol dehydrogenase I expression correlates with CDR1, CDR2 and FLU1 expression in Candida albicans from patients with vulvovaginal candidiasis.
23468174 2013 Association between common alcohol dehydrogenase gene (ADH) variants and schizophrenia and autism.
23456092 2013 Extended genetic effects of ADH cluster genes on the risk of alcohol dependence: from GWAS to replication.
20872569 2010 The activity of class I, II, III, and IV alcohol dehydrogenase isoenzymes and aldehyde dehydrogenase in endometrial cancer.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...