Property Summary

Ligand Count 5
NCBI Gene PubMed Count 46
PubMed Score 265.08
PubTator Score 171.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma -1.600 3.1e-12
lung carcinoma -2.300 2.8e-32
non-small cell lung carcinoma -1.300 4.2e-18
psoriasis -1.800 3.3e-33
ulcerative colitis -1.500 7.3e-07

Protein-protein Interaction (1)

Gene RIF (31)

AA Sequence

MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVTPLPVILGHEA      1 - 70
AGIVESVGEGVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHH     71 - 140
FLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAIM    141 - 210
GCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL    211 - 280
LCCHEACGTSVIVGVPPDSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHV    281 - 350
LPFEKINEGFDLLHSGKSIRTILMF                                                 351 - 375
//

Text Mined References (50)

PMID Year Title