Property Summary

NCBI Gene PubMed Count 98
PubMed Score 731.37
PubTator Score 269.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -2.100 4.3e-03
mucosa-associated lymphoid tissue lympho... -1.085 2.7e-02
pituitary cancer 1.200 1.5e-02

Gene RIF (74)

AA Sequence

MGKITLYEDRGFQGRHYECSSDHPNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWM      1 - 70
GLSDSVRSCRLIPHSGSHRIRLYEREDYRGQMIEFTEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNYR     71 - 140
GRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS                                        141 - 174
//

Text Mined References (100)

PMID Year Title