Property Summary

NCBI Gene PubMed Count 27
PubMed Score 153.96
PubTator Score 7.78

Knowledge Summary

Patent

No data available

Synonym

Accession P07316 Q17RB5 Q53ST2
Symbols CRYG2
CTRCT39

Gene

PDB

1LEU   1MYV   1MYX   1MYY   1MZ1   1MZ2   1MZ3   2JDF   2JDG  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (10)

AA Sequence

MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRRGEYPDYQQWM      1 - 70
GLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILYEMPNY     71 - 140
RGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY                                       141 - 175
//

Text Mined References (28)

PMID Year Title