Property Summary

NCBI Gene PubMed Count 40
PubMed Score 181.81
PubTator Score 58.05

Knowledge Summary

Patent

No data available

Gene RIF (15)

AA Sequence

MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWM      1 - 70
GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYR     71 - 140
GRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY                                        141 - 174
//

Text Mined References (42)

PMID Year Title