Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.77
PubTator Score 3.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Pick disease 1893 1.19987039698106E-4
pilocytic astrocytoma 3086 1.30192869144501E-4
adult high grade glioma 2148 3.31861662142777E-4
osteosarcoma 7933 6.48912293908813E-4
lung cancer 4473 9.25942786478656E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00125151052393787
glioblastoma 5572 0.00382454270426233
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0041140242873979
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00547808988076976
astrocytic glioma 2241 0.0161891797966141
ovarian cancer 8492 0.0203366198674563
aldosterone-producing adenoma 664 0.025503673335229

Expression

  Differential Expression (12)

Synonym

Accession P07311 A6NDV8 B2R590
Symbols ACYPE

Gene

PANTHER Protein Class (2)

PDB

2K7J   2K7K   2VH7   2W4C   2W4P   3TOQ  

  Ortholog (13)

Gene RIF (2)

PMID Text
14992377 two products of the ACYP1 gene are characterized as the result of alternative splicing in which an extra 79 bp long exon is inserted between the two known exons
12409302 Data show that CT acylphosphatase catalyzes the hydrolysis of aryl phosphates and acyl phosphates by two different mechanisms.

AA Sequence

MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRG      1 - 70
SPKSHIDKANFNNEKVILKLDYSDFQIVK                                              71 - 99
//

Text Mined References (15)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19196981 2009 Rational stabilization of enzymes by computational redesign of surface charge-charge interactions.
16511269 2006 Crystallization and preliminary crystallographic analysis of human common-type acylphosphatase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14992377 2004 ACYP1 gene possesses two alternative splicing forms that induce apoptosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12409302 2003 A nucleophilic catalysis step is involved in the hydrolysis of aryl phosphate monoesters by human CT acylphosphatase.
More...