Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.15
PubTator Score 3.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 3.3e-04
aldosterone-producing adenoma -1.068 2.6e-02
astrocytic glioma -1.300 1.6e-02
Astrocytoma, Pilocytic -1.300 1.1e-04
glioblastoma -1.300 3.8e-03
intraductal papillary-mucinous adenoma (... 1.200 4.1e-03
intraductal papillary-mucinous carcinoma... 1.700 1.3e-03
intraductal papillary-mucinous neoplasm ... 2.000 5.5e-03
lung cancer 1.300 7.6e-03
osteosarcoma -1.758 6.5e-04
ovarian cancer 1.300 2.0e-02
Pick disease -1.300 1.2e-04

Synonym

Accession P07311 A6NDV8 B2R590
Symbols ACYPE

Gene

PANTHER Protein Class (2)

PDB

2K7J   2K7K   2VH7   2W4C   2W4P   3TOQ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (2)

AA Sequence

MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRG      1 - 70
SPKSHIDKANFNNEKVILKLDYSDFQIVK                                              71 - 99
//

Text Mined References (15)

PMID Year Title