Property Summary

NCBI Gene PubMed Count 37
PubMed Score 1.24
PubTator Score 10.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 5.1e-04
pancreatic cancer 2398 1.5e-03
pancreatic carcinoma 562 1.5e-03
osteosarcoma 7950 2.1e-03

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.215 2.1e-03
ovarian cancer -1.100 5.1e-04
pancreatic cancer 1.100 1.5e-03
pancreatic carcinoma 1.100 1.5e-03

Gene RIF (10)

AA Sequence

MAKDFQDIQQLSSEENDHPFHQGEGPGTRRLNPRRGNPFLKGPPPAQPLAQRLCSMVCFSLLALSFNILL      1 - 70
LVVICVTGSQSEGHGGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLK     71 - 140
ADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWVEHQGSCYWFSHSGKAWAEAEKYCQLENA    141 - 210
HLVVINSWEEQKFIVQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVE    211 - 280
VQPDGRWNDDFCLQVYRWVCEKRRNATGEVA                                           281 - 311
//

Text Mined References (41)

PMID Year Title