Property Summary

NCBI Gene PubMed Count 35
PubMed Score 0.89
PubTator Score 10.42

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 5.05786993412067E-4
pancreatic cancer 2300 0.0014930654059914
pancreatic carcinoma 567 0.00149306540599144
osteosarcoma 7933 0.00205840762567143


  Differential Expression (4)

Disease log2 FC p
pancreatic cancer 1.100 0.001
osteosarcoma -1.215 0.002
pancreatic carcinoma 1.100 0.001
ovarian cancer -1.100 0.001


Accession P07307 A6NLV8 A8MT12 D3DTM9 D3DTN0 O00448 Q03969 ASGP-R 2
Symbols HL-2


  Ortholog (4)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (8)

23604802 the distribution of ASGR in human testis, was investigated.
22096539 sH2a has the potential to be a uniquely sensitive and specific novel marker for liver fibrosis and function.
21656538 found that the asialoglycoprotein receptor (ASGPR) is involved in hepatocyte recognition of cells predestined for killing, including activated autologous T lymphocytes
20237496 Observational study of gene-disease association. (HuGE Navigator)
19520807 Exposure of beta-galactose results in the rapid clearance of platelets from the circulation by asialoglycoprotein receptor-expressing liver macrophages and hepatocytes.
12119473 primary renal proximal tubular epithelial cells have a functional ASGPR, consisting of the H1 and H2 subunits, that is capable of specific ligand binding and uptake
12089159 trafficks intracellularly and forms homo-oligomers, but does not bind asialo-orosomucoid
11943787 The minor subunit splice variants, H2b and H2c, of the human asialoglycoprotein receptor are present with the major subunit H1 in different hetero-oligomeric receptor complexes

AA Sequence

VQPDGRWNDDFCLQVYRWVCEKRRNATGEVA                                           281 - 311

Text Mined References (39)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23604802 2013 Expression pattern of asialoglycoprotein receptor in human testis.
22096539 2011 A secreted form of the asialoglycoprotein receptor, sH2a, as a novel potential noninvasive marker for liver fibrosis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21656538 2011 Hepatocyte cytotoxicity is facilitated by asialoglycoprotein receptor.
21207081 2011 Asialoglycoprotein receptor interacts with the preS1 domain of hepatitis B virus in vivo and in vitro.
21063834 2010 Establishment of a functional cell line expressing both subunits of H1a and H2c of human hepatocyte surface molecule ASGPR.
20703846 2010 Preoperative estimation of asialoglycoprotein receptor expression in the remnant liver from CT/99mTc-GSA SPECT fusion images correlates well with postoperative liver function parameters.
20364278 2010 Fibronectin and asialoglyprotein receptor mediate hepatitis B surface antigen binding to the cell surface.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.