Property Summary

NCBI Gene PubMed Count 46
Grant Count 57
R01 Count 31
Funding $7,760,467.03
PubMed Score 338.15
PubTator Score 223.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.285 0.000
glioblastoma -1.100 0.006
medulloblastoma, large-cell -1.700 0.000
tuberculosis 2.100 0.000
lung cancer -1.300 0.002
adult high grade glioma -1.200 0.007

Synonym

Accession P07306 I3L1X1 ASGP-R 1
Symbols HL-1
ASGPR
ASGPR1
CLEC4H1

Gene

PDB

1DV8  

Gene RIF (20)

PMID Text
27192541 ASGR1 haploinsufficiency was associated with reduced levels of non-HDL cholesterol and a reduced risk of coronary artery disease.
25485912 Endocytic AMR controls TPO expression through Janus kinase 2 (JAK2) and the acute phase response signal transducer and activator of transcription 3 (STAT3) in vivo and in vitro
25404440 Flow cytometric assessment of ASGPR expression may be a useful predictor of liver dysfunction following major hepatectomy for HCC in Chinese patients.
24933948 Anti-ASGPR levels correlate with biochemical parameters and with the severity and manifestation autoimmune processes in patients with autoimmune hepatitis.
24763545 Anti-ASGPR antibody could be used for specific and efficient HCC CTC enrichment, and anti-P-CK combined with anti-CPS1 antibodies is superior to identification with one antibody alone in the sensitivity for HCC CTC detection.
23979840 The examined ASGPR1 expression levels by immunohistochemistry in HCC with different grades. Guidance for a targeting delivery strategy for anti-cancer drugs to HCC is suggested in this report.
23604802 the distribution of ASGR in human testis, was investigated.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of asialoglycoprotein receptor 1 (ASGR1) in peptide-treated PBMCs
22613667 the cooperative binding mode of Ca(2+) makes it possible for ASGP-R to be more sensitive to Ca(2+) concentrations in early endosomes, and plays an important role in the efficient release of ligand from ASGP-R
22219600 Constant sH2a levels suggest constitutive secretion from hepatocytes in healthy individuals; therefore, a decrease with cirrhosis suggests a diagnostic potential.
More...

AA Sequence

MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIGSQNSQLQEEL      1 - 70
RGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQ     71 - 140
MAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNT    141 - 210
WMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETE    211 - 280
LDKASQEPPLL                                                               281 - 291
//

Text Mined References (52)

PMID Year Title
27192541 2016 Variant ASGR1 Associated with a Reduced Risk of Coronary Artery Disease.
25485912 2015 The Ashwell-Morell receptor regulates hepatic thrombopoietin production via JAK2-STAT3 signaling.
25404440 2014 Flow cytometric analysis of asialoglycoprotein receptor expression predicts hepatic functional reserve after hepatectomy.
24933948 2013 [Diagnostic value of autoantibodies to asialoglycoprotein receptor in autoimmune hepatitis].
24763545 2014 Detection of circulating tumor cells in hepatocellular carcinoma using antibodies against asialoglycoprotein receptor, carbamoyl phosphate synthetase 1 and pan-cytokeratin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979840 2013 Expression of asialoglycoprotein receptor 1 in human hepatocellular carcinoma.
23604802 2013 Expression pattern of asialoglycoprotein receptor in human testis.
22613667 2012 NMR study of ligand release from asialoglycoprotein receptor under solution conditions in early endosomes.
22219600 2011 Constant serum levels of secreted asialoglycoprotein receptor sH2a and decrease with cirrhosis.
More...