Property Summary

NCBI Gene PubMed Count 50
PubMed Score 362.13
PubTator Score 223.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 6.7e-03
glioblastoma -1.100 5.8e-03
lung cancer -1.300 1.5e-03
medulloblastoma, large-cell -1.700 2.8e-05
osteosarcoma -2.285 5.4e-08
tuberculosis 2.100 8.3e-07

Protein-protein Interaction (3)

Gene RIF (24)

AA Sequence

MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIGSQNSQLQEEL      1 - 70
RGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQ     71 - 140
MAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNT    141 - 210
WMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETE    211 - 280
LDKASQEPPLL                                                               281 - 291
//

Text Mined References (56)

PMID Year Title