Property Summary

Ligand Count 7
NCBI Gene PubMed Count 34
PubMed Score 2040.04
PubTator Score 367.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.500 2.5e-02
head and neck cancer -1.100 9.4e-08
intraductal papillary-mucinous neoplasm ... 1.600 2.3e-02
lung adenocarcinoma 1.200 3.0e-04
lung cancer 1.100 1.4e-03
malignant mesothelioma 1.700 2.6e-07
non-small cell lung cancer 1.196 1.4e-14
oligodendroglioma 1.100 4.2e-02
ovarian cancer 1.800 3.3e-04
ulcerative colitis -1.043 3.1e-02

Gene RIF (6)

AA Sequence

MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKL      1 - 70
SIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKA     71 - 140
TPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK                    141 - 194
//

Text Mined References (39)

PMID Year Title