Property Summary

NCBI Gene PubMed Count 30
Grant Count 255
R01 Count 173
Funding $37,078,829.63
PubMed Score 2030.29
PubTator Score 367.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
oligodendroglioma 1.100 0.042
astrocytoma 1.500 0.025
ulcerative colitis -1.043 0.031
non-small cell lung cancer 1.196 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.023
lung cancer 1.100 0.001
lung adenocarcinoma 1.200 0.000
ovarian cancer 1.800 0.000
head and neck cancer -1.100 0.000

Synonym

Accession P07305 B2R6I0 B4DRD6 Q6FG88 Q8N6R3
Symbols H10
H1FV

Gene

Gene RIF (4)

PMID Text
22334665 The N-terminal domain contributes toward the differential chromatin binding affinity, whereas the C-terminal domain contributes toward distinct nucleosomal interface of isotypes H10 and H1c.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
12149419 H1(0)histone may be an important factor in normal DC differentiation. Tumor-derived factors may inhibit DC differentiation by affecting H1(0) expression.
12080050 nuclear transport of H1 histones requires a heterodimeric nuclear import receptor

AA Sequence

MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKL      1 - 70
SIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKA     71 - 140
TPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK                    141 - 194
//

Text Mined References (34)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
24614311 2014 Every amino acid matters: essential contributions of histone variants to mammalian development and disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22334665 2012 N- and C-terminal domains determine differential nucleosomal binding geometry and affinity of linker histone isotypes H1(0) and H1c.
21269460 2011 Initial characterization of the human central proteome.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
19882353 2010 Histone H1 subtype preferences of DFF40 and possible nuclear localization of DFF40/45 in normal and trichostatin A-treated NB4 leukemic cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...